KEGG   Bacillus sp. JS: MY9_1661Help
Entry
MY9_1661          CDS       T02027                                 

Definition
protein MurE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bjs  Bacillus sp. JS
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bjs00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bjs00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1632690..1634174
Genome map
AA seq 494 aa AA seqDB search
MKLTKLLTYLTTEPSVNDSQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVEN
GAAAIVAEREVDVDVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMV
DEILKKAGKRTGLIGTMYMKIGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAIMEVSSH
ALSLGRVHGCDYDIAVFTNLTQDHLDYHKTMDEYRHAKSLLFSQLGGAFNHEHPKRAVLN
ADDEASAYFEKVTAAHISTYGIKNNADVMAKNINITAQGTSFDLVTNKGTKHITMSLVGQ
FNVYNVLAAVATCIAAGIPFEIITEAVEELRGVRGRFELVNQQQEFPVIVDYAHTPDSLE
NVLETCRDMTEGKLFVVVGCGGDRDKTKRPKMAKIAVELADEPIFTSDNPRSEDPRAILR
DMEAGVENAYYHSIANREQAIFFAIANAKKGDVVLIAGKGHETYQQIGNETFDFDDAEVA
ARAIVELNKNKTNS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttacaaagctgcttacatacttaacaaccgaaccttctgtaaacgactcacaa
gaccctgaaataacttcaattgagatggactccagagaagtaaagaaagggagtcttttt
gtatgtgtaaaagggtatacggtggatggccacgattttgcgcaaaaagcagtagaaaac
ggcgcagcggctattgtggcagaacgagaggtcgatgtggatgttcctgttattattgtc
cggcagtcacttcgcgcgctcagcgttttgtctgatgcgttttacggacagccgacgaag
aagcttcagctgattgggataacggggacaaacggcaaaacatcaacgacccatatggtc
gatgagatcttaaaaaaagcgggaaaacgcacaggcttgatcggtacaatgtacatgaaa
atcggagacgaaacacttccagtgaaaaacacgactccggaaagcgtcacgctgcagaaa
acgtttaagaaaatgaatgacaagcacgtcgacactgctatcatggaggtttcttcccac
gccttgtctttaggacgcgtccatggctgtgattatgatattgccgtgtttacgaattta
acacaggaccatctggactatcataaaacgatggatgagtaccggcatgcaaaaagcctg
ctcttttcccaacttggcggggctttcaaccatgaacatccaaagcgtgccgtactgaat
gctgacgatgaggcgagcgcttattttgaaaaggtaacagcagcgcatatctctacatac
ggaattaaaaacaatgctgacgtgatggcgaagaacatcaatatcactgcacagggcaca
agctttgatctcgtgacaaacaaaggcacgaagcacatcacgatgtctctcgtcggacaa
tttaatgtgtataacgtgctggccgctgttgcgacatgtattgcagcaggcataccattt
gaaatcatcactgaggctgttgaagaattgcgtggtgtaagaggacgttttgaattggtc
aatcagcagcaggagtttcctgtcattgtagattacgcgcacacacctgacagccttgaa
aatgtgctggagacatgcagagacatgacggaaggaaagctatttgtcgttgtcggctgc
ggaggagacagagataagacgaaacgcccgaaaatggctaaaattgctgtggagctggct
gacgagccaatttttacttcagataacccgagaagcgaagaccctcgcgcgattttaaga
gatatggaagccggagtagagaacgcatactatcacagtattgcaaaccgcgaacaggcg
atctttttcgcgattgccaatgccaaaaaaggcgacgttgtcctcattgcaggaaaagga
catgaaacctatcagcagatcggaaatgaaaccttcgattttgatgatgctgaagtagcg
gcgagagccattgttgaactcaataagaataagacgaattcatag

DBGET integrated database retrieval system