KEGG   Bacillus sp. JS: MY9_1695Help
Entry
MY9_1695          CDS       T02027                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bjs  Bacillus sp. JS
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bjs00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bjs00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1666826..1667740
Genome map
AA seq 304 aa AA seqDB search
MKHITTMSELSTEEIKDLLQTAQDLKNGKTDNQLTGKFAANLFFEPSTRTRFSFEVAEKK
LGMNVLNLDGTSTSVQKGETLYDTIRTLESIGVDVCVIRHSEDEYYQELVSQVSIPILNA
GDGCGQHPTQSLLDLMTIYEEFNTFKGLTVSIHGDIKHSRVARSNAEVLTRLGARVLFSG
PAEWQDEENTFGTYVSMDEAVESSDVVMLLRIQNERHQSAVSQEGYLNKYGLTVERAERM
KQHAIIMHPAPVNRGVEIDDSLVESEKSRIFKQMQNGVFIRMAVIQRALQTNVKRGEAAY
VISH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatataacgacgatgagtgaactcagcactgaggaaatcaaagatttgcttcaa
acagcacaagacctcaaaaacggaaaaacagacaatcagcttacaggaaagtttgcagca
aacctgtttttcgaaccgagcacgagaacgcggttcagcttcgaggtcgcagaaaaaaag
ctgggcatgaatgtgctgaaccttgatggaacaagcacaagcgtacaaaaaggcgaaacc
ttgtatgacacgattcggacgcttgaatcaatcggtgtggacgtgtgcgtcatcaggcac
agtgaagatgagtattatcaagagcttgtcagccaggtgagcattccgattctgaatgcg
ggagacggatgcggccagcatccgacacaatcactgcttgatttaatgacgatttatgaa
gagttcaatacgttcaaagggcttaccgtctccattcacggtgacatcaagcatagcaga
gtggcaaggtcaaatgcggaagtgttgacaagattgggtgcccgggtcctgttttccggt
cctgcggaatggcaggatgaagaaaatacattcggtacgtatgtctcaatggatgaagca
gttgagtcttccgatgtcgtcatgctgctgcgcattcaaaatgaacggcatcagtccgct
gtcagccaggaaggctatttaaacaaatacggcttgaccgtagaacgggctgagcgtatg
aagcagcatgcgatcatcatgcatcctgctccggtaaacagaggagtggagattgatgac
agcttagtagaaagcgaaaaatcaagaatcttcaagcaaatgcaaaatggcgtatttatc
agaatggcagtgatacagcgtgccttacaaaccaatgtgaaaagaggagaagcagcgtat
gtcatatctcattaa

DBGET integrated database retrieval system