KEGG   Bacillus sp. JS: MY9_1755Help
Entry
MY9_1755          CDS       T02027                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bjs  Bacillus sp. JS
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MY9_1755
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MY9_1755
   00640 Propanoate metabolism
    MY9_1755
   00660 C5-Branched dibasic acid metabolism
    MY9_1755
Enzymes [BR:bjs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MY9_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1727060..1728217
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVESAKSLSSSVYVVKAQIHAGGRGKAGGV
KIAKSLDEVKAYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LSESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatatggggtatctgttcct
gaaggtaaagtggcttttacagcagaagaagcagttgagagtgcaaagagcttatccagc
tcggtttatgtcgtaaaggctcaaattcatgctggcggtcgaggcaaagctggtggggta
aaaatagcaaaatcattagacgaagtaaaagcgtatgccgaagaactattagggaagacc
ctagttacacatcagacgggtccggacggccaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaagaatattacgtgggtcttgtgcttgaccgcgctacttccaga
atcgttctgatggcttctgaagaaggcggaacggaaattgaagaagttgcggagaaaaca
ccggaaaaaatcaaaaaagctgtcattgatccggctgtcggccttcaaggctatcaagcc
agagaaattgcattcgctattaatattccaaaagagcttgtggggaaagctgctaaattt
atgcttggactatataaagcgtttgttgaaaaagactgctcaatcgccgaaatcaacccg
cttgttgttaccggggacggaaatgtgatggcgcttgatgcaaaattgaattttgacagc
aatgcgttgtacagacaaaaggacattatggaatacagagatttggatgaagaagatccg
aaagaaatcgaagcgtccaaatatgacctaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggacttgcaatgtccacaatggatattatcaagcattacggt
ggagaaccggccaacttccttgatgtgggcggcggtgcaaccgcggaaaaagtcacggaa
gcatttaaaatcattctttctgatcaaaacgttaaagggatttttgtcaacattttcggc
ggcattatgaaatgtgatgtcatcgcagaaggggttgttgaagcgactagacaagttggt
ttgacattgccgcttgtcgtccgtcttgaaggcacaaacgtggatctagggaagaaaatc
cttagtgaatcaggattaaacattacatctgcggaatcaatggctgacggcgcgcagaaa
atcgtatccttagtttaa

DBGET integrated database retrieval system