KEGG   Bacillus sp. JS: MY9_1790Help
Entry
MY9_1790          CDS       T02027                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bjs  Bacillus sp. JS
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MY9_1790
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MY9_1790
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MY9_1790
Two-component system [BR:bjs02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   MY9_1790
Bacterial motility proteins [BR:bjs02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MY9_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1758367..1759434
Genome map
AA seq 355 aa AA seqDB search
MIRVLVVDDSAFMRKMISDFLTEEKQIEVIGTARNGEEALKKIELLKPDVITLDVEMPVM
NGTDTLRKIIEIYNLPVIMVSSQTEKGKECTINCLEIGAFDFITKPSGSISLDLYKIKEQ
LVERVVAAGLSGKRNRPVSQTVRPEPIVRVKPELSKPKAGTGRQIVCIGTSTGGPRALQK
VIPKLPKDLNAPVVVVQHMPEGFTASLADRLNHLSDIQVKEAKDGEAALNGCVYIAPGGK
NISVIKSSGGLQIVLDNLDTPSRHKPSADYLFRSVGKLTDYEKVAVIMTGMGSDGTAGLK
DMLTAGNVKAIAESEESCVVYGMPKAAVKAGLIHEIKHVEDIAASITSCVKKERV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgtgtgcttgtagttgatgattcagctttcatgagaaaaatgataagtgatttt
ctgaccgaggaaaagcagatagaagtaatcggaactgccagaaacggagaagaagcgctt
aagaagattgaattattaaaaccggatgttattactcttgatgttgaaatgcctgtcatg
aatgggacagatacgcttcgcaaaattattgagatttataacttgccggtcatcatggta
tcgagccagaccgaaaaaggtaaagagtgcacaattaattgtttggagatcggtgccttt
gactttatcacaaagccatcaggctcaatatctttagatttgtacaaaattaaagaacaa
ttagttgagcgtgtcgtcgcggcaggtctttccggcaagcggaaccgtcctgtttcccaa
acggttcggcccgaacctattgtgcgtgttaagcctgaattgagcaaaccgaaagccggc
acaggcagacaaattgtgtgtatcggcacatcaacaggcggtccaagggcgttacaaaag
gtgataccgaagcttcctaaggacttgaacgcaccagtggttgtcgttcagcacatgcct
gaaggatttactgcttctttggctgatcggctgaatcatttatctgacattcaggtgaaa
gaagcaaaagatggtgaagcagctcttaacggctgtgtttacatagcaccgggcggaaaa
aacatttccgttattaaaagcagcggaggactccagattgtgcttgataatctcgatacc
ccgagccgtcataaaccatctgctgattatttattccgttctgtcggtaaactgacagat
tatgaaaaagtagcggttattatgaccggaatgggcagtgacggcactgcagggctaaag
gacatgctaacagccggcaatgtgaaagccattgcggagtctgaagaatcttgtgtcgtt
tacgggatgccaaaagctgctgttaaagcgggtctcattcatgagattaaacatgtagaa
gatatcgcagcatccatcacaagctgtgtgaaaaaagagagggtgtga

DBGET integrated database retrieval system