KEGG   Bacillus sp. JS: MY9_1802Help
Entry
MY9_1802          CDS       T02027                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bjs  Bacillus sp. JS
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MY9_1802
Enzymes [BR:bjs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MY9_1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1769493..1770644
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTLDVLRAHQDQFQLVSMSFGRNIDKAVPMIEAFQPKFVSVGDLD
TYHKLKQMSFSFECQIGLGEEGLIEAAAMEEVDIVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKEHAKKYDVPLLPVDSEHSAIFQALQGEQAKNIERLIITASGGSFRD
KTREELESVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDKSVIAQLGTPDMRVPIQYALTYPDRLPLPDAKRLELWEIGSLHFEKAD
FDRFRCLQFAFESGKIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEKALTRHQLLK
KPSLADIQEVDKDTRGYVNSILT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatatttgtcttttaggagcaacaggatcaatcggcgaacagactcttgacgta
ctgcgtgcgcatcaagatcaatttcagctggtatctatgtcgtttggcagaaatattgat
aaggccgttccgatgattgaggcctttcagccgaaatttgtctctgtcggtgatctggat
acatatcataaactaaaacaaatgtctttttcttttgaatgccaaatcgggctgggagaa
gaaggactgatagaagcagcagcaatggaggaggttgacattgttgtcaatgctttgctc
ggcagcgttggcctaatcccgacattaaaggcgattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactcttgtcactgcagggcatatagtaaaagaacatgctaagaaatat
gatgttccgctgctgcctgttgacagtgagcattcagccatttttcaagccctccaaggc
gaacaggccaaaaacattgaacgcctcatcattacggcatcaggcggaagctttcgggac
aagacgcgggaggagctcgaatcagtaactgttgaggatgcattaaaacatccgaattgg
tcaatgggtgcaaaaattacaattgattcggctacaatgatgaataagggattagaggtg
atcgaggcacattggctgttcgatataccttatgaacaaattgatgtggttttacataag
gagagcatcatccattcaatggttgagtttcatgataaaagtgtgatcgcgcagcttgga
actccggatatgagagtcccaattcaatatgcgctcacatatcctgaccggttgccatta
ccagatgcgaaaaggcttgaattatgggaaatcggcagccttcattttgagaaagctgat
tttgacaggttccgatgcttacaatttgcatttgaatcaggtaaaataggaggaacaatg
ccgacagtgctaaatgcggcaaatgaagtagctgtcgctgcctttttagccggcaagata
ccgtttttggctattgaagactgtatcgaaaaggcactaacccgccatcaattactgaaa
aaaccgagcctggcggacattcaagaagtggacaaagatacccggggatacgtcaattca
atactcacataa

DBGET integrated database retrieval system