KEGG   Bacillus sp. JS: MY9_1917Help
Entry
MY9_1917          CDS       T02027                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bjs  Bacillus sp. JS
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bjs00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bjs00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1944127..1945464
Genome map
AA seq 445 aa AA seqDB search
MAQSYSSSVNYFGSVNKVVYEGKDSTNPLAFKYYNPQEVIGGKTMKEHLRFSIAYWHTFT
ADGTDVFGAATMQRPWDHYKGMDLAKVRVEAAFEMFEKLDAPYFAFHDRDIAPEGSTLKE
TNQNLDMIVSMIKDYMRNSNVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGL
ETAKELGAENYVFWGGREGYETLLNTDLKFELDNLARFLHMAVDYAKEIGYTGQFLIEPK
PKEPTAHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGS
VDANQGHPLLGWDTDEFPTDLYSATLAMYEILQNGGLGSGGLNFDAKVRRSSFEPDDLIY
AHIAGMDAFARGLKVAHKLIEDRVFEDVIQHRYRSFTEGIGLDIIEGRANFNTLEQYALN
NQSIKNESGRQERLKAILNQYILEV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatcttattctagttcagtcaactattttggaagcgtaaacaaagtggtttac
gaagggaaagattcgactaatcctttagcatttaaatattataatcctcaagaagtaatc
ggcggaaaaacgatgaaagagcatttgcgattttctattgcttattggcatacatttact
gctgatggcacagacgtttttggagcggctacgatgcaaagaccatgggatcactataaa
ggcatggatctagcgaaggtgagagtagaagcagcatttgagatgtttgaaaaactagat
gcaccatattttgcttttcatgaccgggatattgcaccagaaggaagtacgctaaaagag
actaaccaaaatttggatatgatcgtgagcatgattaaagattacatgagaaatagcaac
gttaagctattatggaatactgcaaacatgtttacaaatccccgtttcgtccatggcgct
gcgacttcttgcaatgcagatgtgtttgcgtacgctgcagcacaagtgaaaaaagggtta
gaaacagcaaaagagcttggcgccgagaactatgtattttggggcggccgtgaaggatat
gaaacattgttaaataccgatttaaaatttgagcttgataatttggcaagatttttgcat
atggcagtggattacgcgaaggaaatcgggtacacagggcagtttttgattgagccaaaa
ccaaaagagccgaccgcccatcaatacgatacagatgcagcaacaaccattgccttttta
aagcaatatggcttagacaatcattttaaattaaatctcgaagccaatcatgccacatta
gccgggcatacattcgaacacgaattacgcatggcaagagtgcatggtctgcttggctct
gttgacgcgaaccagggacaccccctgttaggctgggacacagatgaatttccgacagat
ttatattctgcgacattagcaatgtacgaaattctgcaaaatggcggccttggaagcggc
ggattaaactttgacgcgaaggtcagaagatcttcttttgagcctgatgatctaatatat
gcccatattgcagggatggatgcatttgcaagaggattgaaagtcgcccataaattaatc
gaagatcgtgtgtttgaagatgtgattcaacaccgctaccgcagctttactgaagggatt
ggtcttgacattatagaaggaagagctaatttcaatacacttgagcaatatgcgctaaat
aatcaatcaattaaaaacgaatctggaagacaggagcgattaaaagcgatattgaaccaa
tacattttagaagtataa

DBGET integrated database retrieval system