KEGG   Bacillus sp. JS: MY9_1919Help
Entry
MY9_1919          CDS       T02027                                 

Definition
protein XynA
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bjs  Bacillus sp. JS
Brite
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     MY9_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1947357..1948055
Genome map
AA seq 232 aa AA seqDB search
MKQKRMKFLLVVLFSLALTLPAWSAQAATTITSNQTCFQDGYDYELWKDYGNTSMTLNSG
GAFSAQWSNIGNALFRKGKKFDTTKTHSQLGNISIRYNATFNPGGNSYLCVYGWTKDPLV
EYYIVDNWGTYRPTGTPKGTFTVDGGTYDIYETTRINQPSIIGIATFKQYWSVRQTKRTS
GTVSVSEHFKKWESLGMQMGKMYETALTVEGYQSNGSANVTTNVLTVGGKSQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaaagaatgaagtttttgttagtagttttatttagtctagcactgacatta
cctgcatggtccgcacaggcggcaacaacaatcacctcaaatcaaacttgcttccaagat
ggctatgattatgaattgtggaaggattatgggaacactagtatgacgctaaatagcggt
ggcgcgtttagcgcccagtggagtaacattgggaatgctttattccgaaaaggcaagaaa
ttcgatacaaccaagactcactcacaacttggaaatatatcaattcgttacaacgcaacc
ttcaatccgggaggaaattcatatctgtgtgtttatggatggacaaaagatccgctcgta
gaatattacatcgtcgataattggggcacctatagaccgactggaacgcctaaaggtaca
tttactgttgatggagggacatatgacatttacgagaccactagaatcaaccaaccttcc
attataggtatcgcaacctttaaacagtattggagtgtccggcagacaaaacgaacaagc
ggaaccgtatctgtcagcgaacacttcaaaaagtgggaaagcttaggaatgcaaatgggt
aagatgtatgaaaccgcacttactgtagagggctatcaaagtaatggcagtgctaatgta
actaccaatgtattgactgttggtgggaaaagtcaataa

DBGET integrated database retrieval system