KEGG   Bacillus sp. JS: MY9_1980Help
Entry
MY9_1980          CDS       T02027                                 

Definition
protein BglC
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bjs  Bacillus sp. JS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MY9_1980
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MY9_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1992795..1994294
Genome map
AA seq 499 aa AA seqDB search
MKRQVSILIVCLLISILATSGLGNPAASAAGAKTPVAINGQLSIKGTQLINQNGKAVQLK
GISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNTIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQSLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLNYLDSKKISWVNWNLSDKQESS
SALKPGASKTGGWPLTDLTASGTFVRENILGNKDSTKERPETPAQDNPAQENGISVQYKA
GDGGVNSNQIRPQLHIKNNGNTTVDLKDITARYWYNAKNKGQNLDCDYAQIGCGNLTHKF
VTLHKPKQGADTYLELGFKKGKLSPGASTGNTQLRLHNDDWSNYAQSGDYSFFQSNTFKT
TKKITLYNHGKLIWGTEPK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtcaagtctctatcttaatcgtgtgtttattaatttcaatactcgcaaccagc
ggcttaggaaatccagcagcatctgctgcaggagcaaaaacgccagtcgccataaatggc
cagcttagcataaaaggcacgcagctaatcaatcaaaacggcaaagcggtgcaattgaag
gggatcagttcacacggattgcaatggtatggcgattttgtcaataaagacagcttaaaa
tggctgagagacgattggggcattaccgttttccgagcggcgatgtatacagcagatggc
ggttatattgacaacccatccgtgaaaaacaaagtaaaagaagcggttgaagcggcaaaa
gagcttggaatatatgtcatcattgactggcatatcttaaatgacggtaatccaaaccaa
aataaagagaaggcaaaagaattcttcaaggaaatgtcaagcctttacggaaacacgcca
aatgtcatttatgaaattgcaaacgaaccaaacggtgatgtgaactggaagcgtgatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacaccatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgccgatgatcagctaaaa
gatgcaaacgtcatgtacgcgcttcatttttatgccggcacacacggccaatctttacgg
gataaagcaaactatgcactcagtaaaggagcgcctattttcgtgacggaatggggaact
agcgatgcgtctggaaatggcggtgtattccttgaccagtcgcgggaatggctgaattat
ctcgacagcaagaaaatcagctgggtgaactggaatctttctgataagcaggaatcatcc
tcagcgttaaagccgggagcatctaaaacaggcggctggccgcttacagatttaactgct
tcaggaacattcgtaagagaaaacattctcggcaacaaagattcaacgaaagaacgccct
gaaacgccggcacaagataaccccgcacaggaaaacggcatttctgtacaatacaaagca
ggggatgggggtgtgaacagcaaccaaatccgcccgcagcttcacataaaaaataatggc
aatacgacggttgatttaaaagatattactgcccgttactggtataacgcgaaaaacaaa
ggccaaaaccttgactgtgactacgcgcagattggatgcggcaatctgacacacaaattt
gtgacgctgcataaacctaagcaaggtgcagatacctatctggaactggggtttaaaaaa
ggaaagctgtcaccgggagcaagcacaggaaatactcagcttcgtcttcacaacgatgac
tggagcaattatgcacaaagcggcgattattcctttttccaatcaaatacgtttaaaaca
acgaaaaaaatcacattatataatcacggaaaactgatttggggaacagaacccaaatag

DBGET integrated database retrieval system