KEGG   Bacillus sp. JS: MY9_1985Help
Entry
MY9_1985          CDS       T02027                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bjs  Bacillus sp. JS
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MY9_1985
   00052 Galactose metabolism
    MY9_1985
   00500 Starch and sucrose metabolism
    MY9_1985
   00520 Amino sugar and nucleotide sugar metabolism
    MY9_1985
Enzymes [BR:bjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MY9_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1999183..2000076
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAVESGIEDILIITGR
NKRSIEDHFDRSAELEFNLREKGKTETLEEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSETPALRQLMDVYDVYGTEVVGVQSVLPEDVSKYGIINTSGSQ
GHVYEVKDLVEKPSPEEAPSDIAVMGRYVLNSSIFPVLKSIGRGAGNEIQLTDALREVCR
NEPIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLTYLEGVIKRETKEMLR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggttattcccgcagcgggtttaggaacgagatttttg
ccggcgacaaaggcgcagcctaaagaaatgctcccaatcgtcgacaaaccagcaatccaa
tatattgtagaagaggccgtagagtcaggaattgaagatatactgattattacagggaga
aacaaacgctcgattgaagatcattttgaccgatcggcggaattggaattcaatctgcgg
gaaaaaggcaagacggagacacttgaagaaatgcagcagatcgccgatttggccaacatt
cattacatccgccagaaagaaccgctcggattaggccatgcagtactgtgtgcggagcat
tttatcggagatgagccttttgccgttctcttaggtgatgatattatggtgtctgaaaca
ccggctcttcggcaattaatggatgtatatgacgtttatggcacagaggttgtcggtgta
cagtcagttctccctgaggatgtcagcaaatatggtattataaatacatcagggtctcaa
gggcatgtgtatgaagtgaaagatttagttgaaaagccttcacctgaagaagcgccttcc
gacatcgccgtaatgggacggtatgtgttgaattcttcgatcttccccgttttgaagtca
attggcagaggcgcgggaaacgaaattcagctcacagatgcgcttcgtgaggtttgccgt
aatgagccgatccatgctcggctgctggaaggaaatcgatatgacattggcgataagctg
ggctgttttaaagcgagcactgaaatcggcttaatgcgtcccgaaatgagatctcagctt
ttgacctatttagaaggtgtaatcaaacgggaaacgaaagaaatgctgcggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system