KEGG   Bacillus sp. JS: MY9_2118Help
Entry
MY9_2118          CDS       T02027                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00020  Citrate cycle (TCA cycle)
bjs00310  Lysine degradation
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01120  Microbial metabolism in diverse environments
bjs01130  Biosynthesis of antibiotics
bjs01200  Carbon metabolism
Module
bjs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bjs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MY9_2118
  Amino acid metabolism
   00310 Lysine degradation
    MY9_2118
Enzymes [BR:bjs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MY9_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFI28652
UniProt: I0F596
Position
complement(2149740..2150993)
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLQEVLK
DSGDTVQVGEIIGTISEGAGESSAPAPTEKAESKESVKEEKQAEPAAQDVSEEAQSEAKS
RTIASPSARKLAREKGIDLSQVPTGDPFGRVRKQDVEAYEKPASKPAPQQKQQPQAQKAQ
QSFDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFFEQNE
VKLGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAADEGLVVPVVRDADR
LTFAGIEKEIGELAKKARNNKLTLSELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMH
KIQLRPVAIDEERFENRPMMYLALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacaatagcccaa
tggttaaagcagcctggtgactatgtagaacagggtgaatatctgcttgaactagaaacg
gataaagtgaatgttgaattgacagcagaagaatcgggtgtacttcaagaggtattgaaa
gattcgggtgataccgtccaggtcggagaaattatcggtacgatttcagaaggcgcgggt
gaaagttctgcccctgctcctacagagaaagcagaaagcaaggaaagcgtgaaagaagag
aaacaggctgaaccagctgcacaagatgtgagtgaggaagcgcaatctgaagcaaaatca
agaacgatcgcttctccgtcagcccgtaagctggcgagagaaaaaggaattgacctgtct
caagttccaactggagatccgtttggaagagtgcgcaagcaggatgtcgaagcgtatgaa
aaaccagcatcaaaacctgctcctcagcaaaaacagcagcctcaggctcaaaaagcacag
caaagctttgacaaacctgtcgaagtgcaaaaaatgtcacgccgcagacaaacgattgca
aaacgccttgtagaggtgcagcaaacatcggcgatgctgactacatttaatgaagtggac
atgacggctgtcatgaatctcagaaaacgccgcaaagatcaattctttgagcaaaacgaa
gtgaagctcggctttatgtctttcttcacgaaagcggtcgtcgctgcattgaaaaaatat
ccactgttgaatgcggaaattcagggcgatgagttgatcgttaagaaattctatgatatc
ggtatcgctgttgcggctgatgaaggccttgttgttccggtagtacgtgatgcggaccgc
ctgacatttgcaggaatcgaaaaagagatcggcgagctggcgaagaaagcaagaaacaat
aaattaacccttagcgagcttcagggaggttcctttacgattacaaacggagggactttc
ggttcactgatgtcaactccgatcttaaacagccctcaagtcggtatactgggcatgcat
aagattcagctgcgcccagtagcaattgatgaagaacgtttcgaaaaccgtccgatgatg
tatctcgctttatcttatgatcaccggattgtagacggtaaagaagcggttggcttcctc
gtgacaatcaaaaatttactggaagatcctgaacagcttttattagaaggataa

DBGET integrated database retrieval system