KEGG   Bacillus sp. JS: MY9_2118Help
Entry
MY9_2118          CDS       T02027                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bjs  Bacillus sp. JS
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MY9_2118
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MY9_2118
  Amino acid metabolism
   00310 Lysine degradation
    MY9_2118
Enzymes [BR:bjs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MY9_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2149740..2150993)
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLQEVLK
DSGDTVQVGEIIGTISEGAGESSAPAPTEKAESKESVKEEKQAEPAAQDVSEEAQSEAKS
RTIASPSARKLAREKGIDLSQVPTGDPFGRVRKQDVEAYEKPASKPAPQQKQQPQAQKAQ
QSFDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFFEQNE
VKLGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAADEGLVVPVVRDADR
LTFAGIEKEIGELAKKARNNKLTLSELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMH
KIQLRPVAIDEERFENRPMMYLALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacaatagcccaa
tggttaaagcagcctggtgactatgtagaacagggtgaatatctgcttgaactagaaacg
gataaagtgaatgttgaattgacagcagaagaatcgggtgtacttcaagaggtattgaaa
gattcgggtgataccgtccaggtcggagaaattatcggtacgatttcagaaggcgcgggt
gaaagttctgcccctgctcctacagagaaagcagaaagcaaggaaagcgtgaaagaagag
aaacaggctgaaccagctgcacaagatgtgagtgaggaagcgcaatctgaagcaaaatca
agaacgatcgcttctccgtcagcccgtaagctggcgagagaaaaaggaattgacctgtct
caagttccaactggagatccgtttggaagagtgcgcaagcaggatgtcgaagcgtatgaa
aaaccagcatcaaaacctgctcctcagcaaaaacagcagcctcaggctcaaaaagcacag
caaagctttgacaaacctgtcgaagtgcaaaaaatgtcacgccgcagacaaacgattgca
aaacgccttgtagaggtgcagcaaacatcggcgatgctgactacatttaatgaagtggac
atgacggctgtcatgaatctcagaaaacgccgcaaagatcaattctttgagcaaaacgaa
gtgaagctcggctttatgtctttcttcacgaaagcggtcgtcgctgcattgaaaaaatat
ccactgttgaatgcggaaattcagggcgatgagttgatcgttaagaaattctatgatatc
ggtatcgctgttgcggctgatgaaggccttgttgttccggtagtacgtgatgcggaccgc
ctgacatttgcaggaatcgaaaaagagatcggcgagctggcgaagaaagcaagaaacaat
aaattaacccttagcgagcttcagggaggttcctttacgattacaaacggagggactttc
ggttcactgatgtcaactccgatcttaaacagccctcaagtcggtatactgggcatgcat
aagattcagctgcgcccagtagcaattgatgaagaacgtttcgaaaaccgtccgatgatg
tatctcgctttatcttatgatcaccggattgtagacggtaaagaagcggttggcttcctc
gtgacaatcaaaaatttactggaagatcctgaacagcttttattagaaggataa

DBGET integrated database retrieval system