KEGG   Bacillus sp. JS: MY9_2192Help
Entry
MY9_2192          CDS       T02027                                 

Definition
putative peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bjs  Bacillus sp. JS
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MY9_2192
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MY9_2192
Enzymes [BR:bjs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MY9_2192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2210523..2211005)
Genome map
AA seq 160 aa AA seqDB search
MSIYHMKVRTITGKDMTLQPFTGKVLMIVNTASRCGFTPQLKQLQELYDTYQQEGLEILG
FPCNQFMNQEPGEEADIQEFCETNYGVTFSMFSKVDVNGKNAHPLFVYLTEHAKGMLGTK
AIKWNFTKFIVDRNGEIVGRYSPNTNPKELEDAIVKLLGQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctatatatcatatgaaggtacgtacaataacagggaaagacatgacacttcagcct
ttcacgggaaaggtactgatgatcgtgaatactgcaagcaggtgcggttttactccccaa
ttgaagcagctgcaggaattatatgatacatatcagcaggaggggcttgagatcttaggg
tttccctgcaatcaatttatgaaccaagagcctggagaagaggctgacatacaggaattt
tgtgaaacaaattacggtgttacgttttccatgttttcaaaagtggatgtaaacggaaaa
aacgcccatccgctgtttgtgtatttgacagagcatgcaaaaggaatgctgggaactaag
gcaattaagtggaatttcacgaaatttatagtggatagaaatggagaaatcgttggccgt
tattcaccaaatacaaatccgaaagagctggaagatgctatcgtgaagctattagggcaa
tga

DBGET integrated database retrieval system