KEGG   Bacillus sp. JS: MY9_2270Help
Entry
MY9_2270          CDS       T02027                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bjs  Bacillus sp. JS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MY9_2270
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MY9_2270
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MY9_2270
Enzymes [BR:bjs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MY9_2270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2278270..2279472)
Genome map
AA seq 400 aa AA seqDB search
MYPYPNEIGRYGDFGGKFVPETLMQPLDEIETAFKQIKDDPVFREEYYKLLKDYSGRPTA
LTYADRVTEYLGGAKIYLKREDLNHTGSHKINNALGQALLAKKMGKTKIIAETGAGQHGV
AAATVAAKFGFSCIVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEAIRYW
VQHCEDHFYMIGSVVGPHPYPQVVREFQKMIGEEAKDQLKRIEGALPDKVVACVGGGSNA
MGMFQAFLNEDVELIGAEAAGKGVDTPLHAATISKGTVGVIHGSLTYLIQDEFGQIIEPY
SISAGLDYPGIGPEHAYLHKSGRVTYDSITDEEAVNALKLLSEKEGILPAIESAHALAKA
FKLAKGMDRGQIILVCLSGRGDKDVNTLMNVLENEVKARV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatatccgaatgaaataggcagatacggtgattttggcgggaagtttgttccg
gaaacactcatgcagccgttagatgaaatagagacagcatttaaacaaatcaaggatgat
cctgtttttcgtgaagaatattataagctgttaaaggactattccggacggccgactgca
ttaacatatgctgatcgagtcactgaatacttaggcggtgcgaaaatctatttgaaacga
gaagatttaaaccatacaggttcccataaaatcaataatgcgttaggccaagcactgctt
gctaaaaaaatgggcaaaacgaaaatcattgctgaaacgggcgccggacagcacggcgtt
gccgctgcaacagtcgcagccaaattcggtttttcgtgcattgtgtttatgggcgaagag
gatgttgcccgccagtctctgaacgtttttcgtatgaagcttcttggtgcggaagtagtg
cctgtaacaagcgggaacggaacattgaaggatgctacaaatgaggcgatccgttactgg
gttcagcattgcgaggatcatttttacatgattggatcagttgtcggtccgcacccttat
ccgcaagtggtccgcgaatttcaaaaaatgatcggagaggaagcgaaggatcagctaaaa
cgtattgaaggcgctctgcctgataaagtagtggcatgtgtaggcggaggaagcaatgcg
atgggtatgtttcaggcatttttaaacgaagatgttgaactgatcggagctgaagctgca
ggaaaaggagtagatactcctcttcatgccgccactatttcgaaaggtacggtaggggtt
attcacggttcattgacatatctcattcaggatgagttcgggcagataattgagccttac
tctatttcagcaggtctcgactatccggggatcggtccggagcacgcttacttgcataag
agcggccgtgtcacttatgacagtatcacagatgaagaagcggtgaatgcattaaagctc
ttgtcagaaaaagaggggattttgccggcaatcgaatctgcccatgcgttagcgaaggca
ttcaaactcgccaaaggaatggatcgcggtcaaatcattctcgtttgtttatcaggacgg
ggagataaggatgtcaacacattaatgaatgtattggaaaatgaggtgaaagcccgtgtt
taa

DBGET integrated database retrieval system