KEGG   Bacillus sp. JS: MY9_2272Help
Entry
MY9_2272          CDS       T02027                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bjs  Bacillus sp. JS
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MY9_2272
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MY9_2272
Enzymes [BR:bjs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MY9_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2280105..2280857)
Genome map
AA seq 250 aa AA seqDB search
MLENIIKQKKEEVKTLVLPVEQPFEKRSFKDALASPNRFIGLIAEVKKASPSKGLIKEDF
VPVRIAKDYEAAKADALSVLTDTPFFQGENSHLSDVKRAVSIPVLRKDFIIDSLQVEESR
RIGADAILLIGEVLDPLHLYELYLEAGEKGMDVLVEVHDASTLEQILKVFTPDILGVNNR
NLKTFETSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNEHGARAVLIGESLMRQTSQ
RKAIHALFGE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaatatcatcaaacaaaagaaagaagaagtgaaaacactggttctgccggta
gagcagcctttcgaaaaacgttcatttaaagatgcgttggcaagcccgaatcggtttatc
ggactgattgccgaagtgaagaaagcatcaccgtcaaaagggctgattaaagaggatttt
gtccctgtgcggattgcaaaagactatgaagctgcgaaggcagatgcgctttccgtttta
acagacaccccgttttttcaaggggaaaacagccatttatcagatgtaaagcgcgctgtt
tcgattcctgtactcagaaaagattttattattgattctcttcaagtggaggaatcaaga
agaatcggtgcggatgccatattgttaatcggcgaggtgcttgaccctttacacctctat
gaattatatcttgaagcaggcgaaaaggggatggacgtgttagtggaggttcatgatgca
tcaacgctagaacaaatattgaaagtgttcacacctgatattctcggcgtaaataaccgt
aacctaaagacgtttgaaacatctgtaaagcagacagaacaaatcgcatctctcgttccg
aaagaatctctgcttgtcagcgaaagcggaatcggttctttagaacatttaacatttgtc
aacgaacatggggcgcgagctgtacttatcggtgaatcattgatgagacaaacttctcag
cgaaaagcaatccatgctttgtttggggagtaa

DBGET integrated database retrieval system