KEGG   Bacillus sp. JS: MY9_2509Help
Entry
MY9_2509          CDS       T02027                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bjs  Bacillus sp. JS
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MY9_2509
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MY9_2509
   00052 Galactose metabolism
    MY9_2509
   00500 Starch and sucrose metabolism
    MY9_2509
   00520 Amino sugar and nucleotide sugar metabolism
    MY9_2509
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MY9_2509
   00524 Butirosin and neomycin biosynthesis
    MY9_2509
Enzymes [BR:bjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MY9_2509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2477422..2478387)
Genome map
AA seq 321 aa AA seqDB search
MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKTGDTITVTIAKTIDSKLDELQKP
KHLIKYIGMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIANGEIVHGINGAGGEIGHICSIPEGGAPCNCGKT
GCIETIASATGIVRIAKEKIANAKQTTRLKATEQLSARDVFEAAGENDEIALEVVDYVAK
HLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAFPRAAQAADISIAALGN
DAGVIGGAWIAKNEWLKHQNC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggatgagatttggtttgcgggcattgacctgggaggaacgacgattaaactcgctttt
attaatcaatatggtgaaattcagcataaatgggaagtcccgactgataaaaccggcgac
accattaccgttacaattgcaaaaacaatcgacagcaagctggatgagctgcaaaaaccg
aagcacctcattaaatacatcggaatgggcgcaccaggtcctgtagatatggcggcagga
gttgtgtatgaaaccgtaaatctaggatggaaaaattacgctttaaaaaaccatttggag
acagagaccggcatcccagcagtgatagaaaatgacgcgaatattgctgcgcttggggaa
atgtggaaaggagcgggtgatggcgcaaaggacgtcattctcgtgacgcttggcacagga
gttggaggcggcattattgcaaatggtgaaattgtacatggcataaatggcgcaggcgga
gaaatcggccatatttgcagcatccctgaaggcggagcgccttgcaactgcggcaagacg
ggctgtatcgaaaccattgcatcggcaacaggaattgtaagaattgcaaaagaaaaaata
gcgaatgctaagcagacgacacgtttaaaagcaactgaacaattgtcagcgcgggatgtg
tttgaagcggctggtgaaaatgacgaaattgcccttgaggtggttgattatgtagccaag
caccttggtttggtgctcggaaatttggcaagctcgcttaatccgtcaaaaatcgttctt
ggcggcggcgtatcgagagccggagagctgctgagatcaaaagtagagaaaacattccgc
aaatgcgcgtttccgcgggcagcccaagctgctgatatttcaatcgcagcgcttggaaat
gatgccggcgttattggaggcgcttggatcgctaaaaacgaatggctaaaacaccaaaat
tgttaa

DBGET integrated database retrieval system