KEGG   Bacillus sp. JS: MY9_2728Help
Entry
MY9_2728          CDS       T02027                                 

Definition
helicase, RecD/TraA family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bjs  Bacillus sp. JS
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MY9_2728
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MY9_2728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2669440..2671836)
Genome map
AA seq 798 aa AA seqDB search
MQQHPDQLKLEEEPYLKGTVNTVIYHNDTNLYTVLKVKVTETSEAIEDKAVSVTGYFPAL
QEEETYTFYGKIVTHPKFGLQFQAEHFKKEIPTTKEGIIQYLSSDLFEGIGKKTAEEIVK
KLGDSAINKILADASVLYDVPRLSKKKADTLAGALQRHQGLEQIMISLNQFGFGPQLSMK
IYQAYESETLEKIQENPYQLVKDVEGIGFGKADELGGRMGLSGNHPERVKAAILYTLETT
CLSEGHTYIETEQLIIDTQSLLNQSAKEDQRITEMDAANAIIALGENKDIVIEDGRCYFP
SLFYAEQNVAKRVKHIASQTEYDDQFPESEFLLALGELEERMNVQYAPSQKEAIQKALSS
PMLLLTGGPGTGKTTVIRGIVELYGELHGVSLDPSAYKKDEAFPIVLAAPTGRAAKRMSE
STGLPAVTIHRLLGWNGAEGFTHTEDQPIEGKLLIIDEASMLDIWLANHLFKAIPDHIQI
IIVGDEDQLPSVGPGQVLRDLLASQVIPTVRLTDIYRQAEGSSIVELAHQMKNGLLPNNL
TAPTKDRSFIRCGGSQIKEVVEKVVANALKKGYTAKDIQVLAPMYRGKAGINELNVMLQD
ILNPPKEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEITSIFYAKENTEKEDMA
VVSFDGNEMTFTKKDFNQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAIT
RAKKFLILCGEEEALEWGVKNNDATVRQTSLKNRLSVQVEEMDAELEALQKELPFSVHDA
NIGMEGITPFDFMKEEQL
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagcatccggatcagcttaaactggaggaagagccctatttaaaagggacagtt
aacacagtcatctatcataatgacaccaatttatatacggttctgaaagtgaaagtcaca
gagacctccgaagccatagaagataaagccgtatccgtgacgggctacttccctgcgctt
caagaagaagagacctacacgttttacggaaagatcgtaacacacccgaaattcgggctc
caatttcaagcggagcatttcaaaaaagagataccgacgactaaggaaggcattatacaa
tatttatcgagtgatttattcgagggaatcggcaaaaaaacagctgaagaaattgtgaaa
aagctgggcgacagcgccattaacaaaatattggctgacgcttcagtgctttatgatgtt
ccgaggctctcaaaaaagaaagcagacacgctggccggtgccttgcagcggcatcagggg
ctggagcaaatcatgatttccctgaaccagtttggctttggcccgcagctgtccatgaaa
atctatcaagcctatgaatccgagacgcttgaaaagattcaagaaaatccttatcagctt
gtgaaggacgtagaaggcatcgggtttggaaaagcggatgagctgggcggcagaatgggt
ctttcgggtaatcatcctgagcgggtaaaagctgcgattctgtacacgcttgaaacgact
tgtctgtcagaggggcacacgtacatagaaacggagcagctgatcatcgatacccaatca
ctgttaaaccagtcagcaaaggaagatcagcgcatcacagaaatggatgccgctaacgcg
attattgctcttggagaaaataaagacattgtcatagaagatggacgctgttattttcca
tcgctgttttacgctgaacaaaatgttgctaagcgagtgaaacatatcgcaagccaaact
gaatatgatgaccagtttcccgaatcagagtttttgctcgctttgggggaattggaagaa
cggatgaacgttcagtatgcccccagccagaaagaagcgattcaaaaagctctttcctcg
ccgatgcttcttttaacaggcggcccaggaacagggaaaacgacggttatcagagggatt
gtcgagctctacggagagcttcacggtgtgtcactagacccgtcagcttataaaaaggat
gaagcttttccgattgttttggccgctccgacagggagagcagcaaaacgaatgagtgaa
tcaacgggacttcctgcagtcacgatacacaggctgcttggctggaacggtgctgaaggc
tttactcatacagaggatcagccgatcgaagggaagctgttaattatcgatgaagccagt
atgcttgatatatggctggcgaatcatttgttcaaggcgatccctgatcatatccaaatc
atcattgtcggagacgaagaccagttgccttctgtaggtccgggccaagtgctgagagac
ctactggcatcccaggtgattcccacggtgagactgacagacatctaccgccaggctgag
gggtcatcaatcgtcgagcttgcccaccagatgaaaaatggattgctgccgaacaatttg
actgcccccacaaaggaccgatcctttattcgctgcggaggctcgcaaattaaagaagtt
gttgaaaaagttgtcgccaatgcattgaaaaaaggctatacggcaaaggacattcaggtc
ctcgctccgatgtacagaggaaaagctggcatcaatgagttgaatgtgatgctgcaggac
attttaaatcctcctaaagaaaaacggagagaattgaagttcggggatgttgtctacaga
accggagataaaattttgcagcttgtcaatcagccggaaaacaatgtattcaacggagat
attggcgaaattacgtcgatattttatgcaaaggaaaatacagaaaaagaagacatggcc
gtcgtttcttttgatggcaatgaaatgacgtttacgaaaaaagattttaatcaatttacc
catgcgtattgctgttctattcataaatcgcagggaagtgaatttccgattgtggttttg
cctgttgtgaaaggctactatagaatgctcagaagaaaccttctttataccgcgattaca
agagcgaagaaatttctcattttatgcggggaagaggaggcgctggagtggggcgtgaaa
aataatgatgcaactgtcagacagacctccttaaaaaacaggctgtccgtacaggttgag
gaaatggatgccgagcttgaggctctccaaaaagagctcccattcagcgtacacgacgcc
aacattggcatggaaggcattacaccatttgattttatgaaagaagaacagctgtaa

DBGET integrated database retrieval system