KEGG   Bacillus sp. JS: MY9_2798Help
Entry
MY9_2798          CDS       T02027                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bjs  Bacillus sp. JS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bjs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2737435..2738409)
Genome map
AA seq 324 aa AA seqDB search
MSQSFNRHRRLRTSNAMREMVKETRLHPSDFIYPIFVVEGLEGKKAVPSMPDVYHVSLDL
LKDEVAELVKLGIQSVIVFGIPEEKDDCGTQAYHDHGIVQKAITEIKKHFPEMVVVADTC
LCEYTDHGHCGLVKDGVILNDESLELLAQTAVSQAKAGADIIAPSNMMDGFVTVIREALD
KEGFVNIPIMSYAVKYSSEFYGPFRDAANSTPQFGDRKTYQMDPANRMEALREAQSDVEE
GADFLIVKPSLSYMDIMRDVKNEFALPLVAYNVSGEYSMVKAAAQNGWIKEKEIVLEILT
SMKRAGADLIITYHAKDAAKWLAE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcatttaatagacaccgccgcctgcggacatcaaatgcaatgagagagatg
gtaaaggaaacacgtttgcatccatccgattttatctatccgatttttgtcgtagaaggg
cttgaaggcaaaaaagctgttccgtcaatgcctgatgtttatcatgtatcattagatcta
ttgaaggatgaagtagctgagctggtcaaactgggaattcaatctgttatcgtgttcggc
atcccggaagaaaaggatgattgcggaactcaagcgtaccatgatcatggtatcgttcaa
aaagccatcacggaaattaaaaaacacttccctgaaatggtggttgtcgctgacacgtgc
ttatgcgaatatacagaccacggccattgcggacttgtcaaagacggggtcatcctcaat
gatgaatcgcttgagcttttagcacagacagctgtcagccaagcgaaggcaggtgcggat
atcattgcgccatcaaacatgatggacggatttgttacagtgatcagagaagcgctcgat
aaagaaggattcgtcaatattccaatcatgtcttacgctgtaaaatattcaagtgagttt
tacggtccgttccgtgacgcagcaaacagcacaccgcaatttggtgaccgcaaaacatat
cagatggatcctgccaaccgtatggaggcactccgcgaagcacaatcagatgtcgaggaa
ggcgcggactttttgattgtcaaaccttcgctttcctatatggatatcatgcgtgacgtg
aaaaatgagtttgctttgccgctcgtcgcttataatgtaagcggagagtattcaatggtg
aaggctgcagcgcagaacggctggatcaaagaaaaagaaatcgtgttggaaattttgaca
agcatgaagcgcgcgggtgccgacctgattattacgtatcatgcgaaagacgcagcgaaa
tggcttgcggagtaa

DBGET integrated database retrieval system