KEGG   Bacillus sp. JS: MY9_2844Help
Entry
MY9_2844          CDS       T02027                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00071  Fatty acid degradation
bjs00362  Benzoate degradation
bjs01100  Metabolic pathways
bjs01120  Microbial metabolism in diverse environments
bjs01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MY9_2844
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MY9_2844
Enzymes [BR:bjs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MY9_2844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFI29377
UniProt: I0F7C1
Position
complement(2780386..2781162)
Genome map
AA seq 258 aa AA seqDB search
MNAISLTVDQFVAILTIHNPPANALSSQILEELSSCLDQCETDAGVRSIIIHGEGRFFSA
GADIKEFTSFKGNEDSSLLAERGQQLMERIESFPKPIIAAIHGAALGGGLELAMACHIRI
AAEDAKLGLPELNLGIIPGFAGTQRLPKYVGTAKALELIGSGEPISGKEALDLGLVSIGA
KDEAEVLEKAKALAAKFAEKSPQTLASLLELLYSNKVYSYEGSLKLEAKRFGEAFESEDA
KEGIQAFLEKRKPQFKGE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaatttcacttacggtggatcaatttgtggcaatcttgacgattcacaatccg
ccggcaaacgcgctttccagccagatattagaagagctgtcttcctgtcttgatcaatgt
gagacagatgcaggcgtacgaagcattatcattcacggcgagggaagatttttctcagcc
ggcgctgatattaaagaattcacatcgtttaaaggcaatgaggattcctcattgctcgct
gagcgcggccagcagttaatggagagaatcgaaagctttccaaaaccgattatcgcagcg
attcacggcgctgctctcggaggcgggctggagcttgcaatggcctgtcacatcagaatc
gcggcagaagatgctaagctggggctcccagagcttaaccttggtatcatcccgggtttt
gcaggaacacagcgtcttccgaaatatgtcggtacagccaaggcactagagctcatcggc
tcaggagaaccgatatccggaaaagaagcgcttgatctcggacttgtctcaattggagca
aaagatgaggcagaagtgcttgaaaaagcaaaagcacttgccgctaagtttgcagagaaa
agcccgcaaacgcttgcgtctttgcttgagcttctttattccaacaaggtgtattcctac
gaaggaagcttaaagcttgaagcaaaacgatttggggaagcatttgagtcagaggacgcc
aaggaaggcatccaggcatttctcgaaaaaagaaagcctcaattcaaaggcgaataa

DBGET integrated database retrieval system