KEGG   Bacillus sp. JS: MY9_2899Help
Entry
MY9_2899          CDS       T02027                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bjs  Bacillus sp. JS
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MY9_2899
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MY9_2899
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MY9_2899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2836660..2837493)
Genome map
AA seq 277 aa AA seqDB search
MDVPELPEVETVRRTLTGLVKGKTIKSVEIRWPNIIKRPAEPEEFARNLAGETIQSIGRR
GKFLLFHLDHYVMVSHLRMEGKYGLHQAKEPDDKHVHVIFTMTDGTQLRYRDVRKFGTMH
LFKPGEEAGELPLSQLGPEPDAEEFTSAYLKERLAKTNRAVKTALLDQKTVVGLGNIYVD
EALFRAGVHPETKANQLSDQTIKTLHAEIKNTLQEAIDAGGSTVRSYINSQGEIGMFQLQ
HFVYGKKDKPCKNCGTMISKIVVGGRGTHFCARCQKK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgccggaattaccagaggttgagacggtccggcgcactctgaccgggcttgta
aagggaaaaacaatcaaatcggtagagatcagatggccgaatatcatcaaacggcctgcc
gagccggaggaatttgcgcgaaatctagcaggagaaacgatacagtctatcggaagacgg
ggaaagtttttgctgtttcatttagatcattatgtcatggtttcccacctgcgaatggaa
gggaaatacgggcttcatcaagcgaaggagccagacgataaacatgtgcatgtcatattt
acgatgacggatggaacccagctccgttacagagatgttcggaagtttggaaccatgcac
ttatttaaaccgggagaagaggcgggcgagctcccgctttctcagttaggtccggagccg
gatgcagaagaatttacgagtgcatatttaaaagaacggcttgccaaaacaaaccgcgct
gtcaaaactgccctgctggatcaaaaaacggtcgtcggactagggaacatttatgtggac
gaggctcttttcagagcgggtgtccatcccgagacaaaagcaaatcaattatcagatcag
acaatcaaaacccttcacgctgaaatcaaaaataccctgcaggaagcgattgatgcaggc
ggcagcacagtccgctcgtatatcaactcccaaggggaaatcggaatgttccagctgcag
cattttgtgtacggaaaaaaagacaagccatgcaaaaattgcggaacgatgatttcgaaa
attgtcgtcgggggaaggggcacgcatttttgcgcaaggtgccagaaaaaatag

DBGET integrated database retrieval system