KEGG   Bacillus sp. JS: MY9_3001Help
Entry
MY9_3001          CDS       T02027                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bjs  Bacillus sp. JS
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MY9_3001
  Amino acid metabolism
   00300 Lysine biosynthesis
    MY9_3001
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MY9_3001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2931773..2933164)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRRKEDLIRDTQEFLRINSVMDETTAGPGKPFGEGVNASLTSLLELGEKEGFT
TKNLDGFAGHIEWGEGDDIVGVLCHVDVVPPGDDWTSDPFSAEIRNGRIYARGAIDDKGP
TMAAFYALKIVKDMNLPLSKRVRMIIGTDEESDWRCVEHYFKHEEMPTLGFAPDADFPII
NAEKGIIDASLLIPHVANQAEPKAVLVSFQSGLRLNMVPDAAEAVIEGQKKEEILSSFKD
MLRTTDQKGEAEIENGQLILRMYGLSCHAMEPNNGINAGILLCEFLQQTELDDAGLRFVQ
VVTDKFSGDTRGKKLNIDCEDEISGELTLNVGTLCYKEGQGGELGINIRYPVTAESKAIR
DVFESATEFELGEFKDSKPHHVSADHPLVKTLQKVYEGQLGKKADLISIGGGTYARSLKA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagttgaagtgatcagaagaaaagaggatttaattcgtgatacgcaggaa
tttttgagaatcaacagtgtcatggacgaaacaaccgccggacccggcaaaccgtttgga
gaaggggtaaacgccagcctgacttcactgctggagcttggagaaaaagaaggctttaca
acaaaaaatcttgatggcttcgcaggtcatattgaatggggcgagggcgatgacattgtc
ggcgtactttgccatgttgacgtcgtgccgccgggagacgattggacgagtgatccgttt
tcagctgaaatccgtaatgggcggatttatgcaagaggcgccattgatgacaaaggcccg
acaatggcagcattctatgcgctgaaaatcgtaaaagacatgaatttgccgctgtccaag
cgagtcagaatgattatcggaacagatgaagaaagcgattggagatgcgtagagcattac
ttcaagcatgaagaaatgccaacacttggctttgcgcctgacgccgattttccgattatt
aacgcggaaaaagggattatcgatgcttctttacttatcccgcatgtcgcaaatcaagcc
gagccaaaggcagtgcttgtctcgtttcagtcaggcctccgtttgaacatggtgcctgac
gctgctgaagccgtcattgaagggcagaaaaaagaagagattctgtcttcatttaaagac
atgctccgcacgacggatcaaaaaggagaagctgaaatagagaacggacagctcattttg
cgtatgtacgggctttcctgccatgcgatggaaccgaacaatgggatcaatgccggcatt
ttattgtgcgaatttctgcagcagactgagcttgacgatgcaggactgcggtttgtgcaa
gtggtgacagacaaattctcaggtgatacaagaggaaagaaactgaacatcgactgtgag
gatgaaattagcggtgagctgacattaaacgtcggaacactgtgctataaagaagggcaa
ggaggcgagctcgggatcaatatccgctatcctgtgacagcagaaagcaaagcgatccgg
gatgtattcgaaagcgcaactgaatttgagctgggcgaattcaaagacagcaagccgcat
catgtgtcagcagatcatccgctagtcaaaaccctgcaaaaggtttatgaaggccagctg
ggtaaaaaagctgacttaatctcaatcggcggagggacgtatgccagatcgctaaaagcc
ggtgtcgccttcggcccgctgttccccggacgccctgacagcgcacatcaaaaggatgaa
tatattgaaattgatgaccttcttagatcgacagcattatatgcgcaggccatttacgag
cttgcaaaataa

DBGET integrated database retrieval system