KEGG   Bacillus sp. JS: MY9_3031Help
Entry
MY9_3031          CDS       T02027                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bjs  Bacillus sp. JS
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MY9_3031
  Lipid metabolism
   00561 Glycerolipid metabolism
    MY9_3031
   00600 Sphingolipid metabolism
    MY9_3031
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MY9_3031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2965762..2967060
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDPKRLQESQLMLENLRDRYNPS
VAINSYDDRKLALQNAGYVINAIQVGGYKPSTVIDFEIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIARDMEEMCPDAWFLNYTNPMASLTGAMLRYTNIKTIGLCHSVQVCTKDLC
KALGMEHDGIEERIAGINHMAWLLEVKKDGADLYPEIKRRAKEKQKTKHHDMVRFELMDK
FGYYVTESSEHNAEYHPYFIKRNYPELISELQIPLDEYPRRCVKQIENWEKMRDDIVNNK
NLTHERSKEYGSRIIEAMETNEPFTFGGNVLNTGLITNLPSKAVVEVTCVADRKKITPCF
SGELPEQLAALNRTNINTQLMTIEAAVTRKKEAVYQAAMLDPHTSAELSMKDIISMCDDL
FAAHGDWLPEYK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattacatttatcggcgcaggaagcacgattttcgccaaaaatgtgttggga
gactgcctgttaacagaggcactgaatggatttgagttcgcgctttacgacattgatccc
aaacgcctgcaggaatcccagctcatgctcgaaaatctaagagaccgctataacccgagt
gtggcgatcaacagctatgatgacagaaaacttgccttgcaaaacgcaggctatgtcatc
aatgcgattcaggttggaggttacaagccgagcacagtcatcgatttcgagattcctaaa
cggtatgggctgcgccagacgatcgccgatacagtcggcatcggcgggatattcagatct
ctcagaacaatcccggtcttatttgacatcgcaagagatatggaggaaatgtgcccggat
gcgtggtttttaaactatacaaatcctatggcttctcttacaggcgccatgcttcgctat
accaatatcaaaacaatcgggctctgccacagtgtccaagtgtgcacgaaggatttatgt
aaagctctcggaatggagcatgacggaattgaggaacgcattgcgggcatcaatcatatg
gcttggcttttggaagtcaaaaaagacggcgcagatttgtatccagaaatcaaaaggaga
gcgaaagaaaaacaaaaaacaaagcatcatgatatggtgcggtttgaattaatggataag
tttggctattatgtcacggaatcatccgaacacaacgcagagtatcacccgtactttatt
aaacggaattaccctgaactgatcagcgagctgcaaatcccgctcgacgaatatccgaga
aggtgcgtcaagcagattgaaaattgggagaaaatgcgggatgacattgtcaacaataaa
aaccttacgcacgaacgctccaaggaatatggttctagaattatagaagcaatggaaaca
aacgagccattcaccttcggaggaaacgtcttgaatacaggactgatcaccaaccttcct
tcaaaagcggttgtggaagtgacatgcgtcgccgacagaaaaaaaattacaccgtgcttc
tcgggagaactgcctgagcagcttgcagccttaaaccggacgaatattaatacacagctg
atgacaatcgaagcggctgtcacacggaaaaaagaagcggtttaccaagctgcaatgctt
gatccgcatacaagtgcggagctttccatgaaggacatcatttccatgtgtgacgattta
tttgcagcacatggcgattggcttccggaatacaaataa

DBGET integrated database retrieval system