KEGG   Bacillus sp. JS: MY9_3054Help
Entry
MY9_3054          CDS       T02027                                 

Definition
phospholipase component of bacilysocin synthesis or export
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bjs  Bacillus sp. JS
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bjs00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2987338..2988117)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVAVVVIIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGTTTRARGHIRS
FQEYIDEVDAWIDKARTFDLPVFLLGHSMGGLVAIEWFKQQRNPRITGIILSSPCLGLQI
KVNKALDLASRGLNVIAPSLKVDSGLSIDMATRNEDVIEADQNDSLYVRKVSVRWYRELL
KTIESAMVPTDAFLKVPLLVMQAGDDKLVDKTMVIKWFNGVASHNKAYREWEGLYHEIFN
EPEREDVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctggaaagcagacagacctgttgcagtggttgtaatcattcacggggcaagt
gaatatcatggacgatataaatggctgattgaaatgtggcgatcttcgggttatcacgtt
gtcatgggcgatttgcctggacagggaacaacgacaagggcaagagggcatattcgctct
tttcaagaatacattgatgaagtagatgcttggatagataaagcgcgaacctttgatctg
ccggtttttcttttaggtcacagcatgggcggtctggtcgcgattgaatggtttaaacaa
caaagaaatccccgcattacgggaattattttatcatcaccgtgtctcggactgcaaatt
aaagtcaataaagcgcttgaccttgcatcaagaggcctgaatgttatcgctccgtcgctt
aaggttgattcgggattatcaattgatatggcgacgcgcaatgaggacgtcatcgaggct
gaccaaaatgattcgttatacgtcaggaaagtttctgtcagatggtacagagagctttta
aagacaattgagtcagcgatggtgccgacagatgcatttttgaaagtgccgcttcttgtg
atgcaggccggtgatgacaagcttgttgataaaacgatggtcatcaagtggtttaatggc
gttgcttctcataataaagcgtacagagagtgggaagggctttaccatgagatctttaat
gaacccgaaagagaagatgtctttaaagcagcaagagcgtttactgatcaatatatttga

DBGET integrated database retrieval system