KEGG   Bacillus sp. JS: MY9_3104Help
Entry
MY9_3104          CDS       T02027                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bjs  Bacillus sp. JS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MY9_3104
Enzymes [BR:bjs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MY9_3104
Exosome [BR:bjs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MY9_3104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3034453..3036336)
Genome map
AA seq 627 aa AA seqDB search
MAAASPTAHDVYLFHEGSLFKSYQLFGSHFRELNGTSGYEFCVWAPHASEVRVAGDFNSW
SGEQHVMHRVNDNGIWTLFIPGLGEKERYKYEIVTNCGEIRLKADPYAIYSEVRPNTASL
TYDLEGYSWQDQKWQKKQKTKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYI
KEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMRFVDECHQQNIGVILDW
VPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEF
YHIDGFRVDAVANILYWPNQDERHTNPYAVEFLKKLNQTMREAYPQVMMIAEDSTEWPQV
TGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHD
EVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDW
FLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKH
SEALVIICNFTPAVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHK
PCYITMTIPPYGISILRAVRKRGEIKR
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgccagccctacagcacatgatgtttatctttttcacgaaggcagtctgttt
aaaagctatcagctgtttggctcgcattttcgtgagctgaatggcacaagcggatatgaa
ttctgtgtgtgggcgcctcatgcgtcggaagtacgagtggctggggattttaacagctgg
tcgggagaacagcatgtgatgcacagagtgaatgataatggcatttggacgttatttatt
ccgggtttaggagaaaaggaacgatataaatatgaaatcgtgacgaattgcggtgagatt
aggctgaaggcagatccatacgccatttattcagaagtcagaccaaacacagcgtcactt
acttacgatttggaagggtacagctggcaagatcaaaaatggcaaaagaaacagaagact
aagacgctgtatgagaaacctgttttcatttatgaactgcatctcgggtcttggaagaag
cattctgatggcaggcattactcctataaagagttaagtcagacacttattccgtatatc
aaagagcatgggtttacccatattgaactgcttccagtgtatgagcatccatatgatcgt
tcctggggctaccaaggaacggggtattacagcccgacaagcaggtttggcacaccgcac
gatctgatgaggtttgttgatgaatgtcatcaacaaaatatcggagtcattttagattgg
gttcctggacatttttgtaaagatgcacatggcctttatatgtttgatggagaaccgctt
tatgaatacaaagaagaacgtgatcgggagaactggttatggggtacggcaaattttgac
ctgggaaaaccagaagttcatagttttttaatttcgaatgcgttgtactgggcggaattc
tatcatatagatggatttagggttgatgcagtggctaatatcttgtattggccaaatcag
gatgaacgccacacgaatccatatgctgttgaatttttaaaaaaactcaatcaaaccatg
agagaggcgtatccacaggtgatgatgatcgcggaagattctacagaatggcctcaagtg
acaggtgccgttgaggaaggggggcttggttttcattataaatggaatatgggatggatg
aatgacgtactgaaatacatggagacgccgcctgaagaaaggcggcattgtcatcagctt
atctctttttcattactgtatgcgtttagtgaacattttgtgttgccgttttctcatgat
gaagtcgtatacgggaaaaaatcacttcttaataaaatgcctggcgactactggcagaaa
tttgcccagtatcggcttttgctgggctatatgacagtgcatcccggaaagaaattaatc
tttatgggatcagagtttgcccaatttgatgaatggaaagatacagaacagcttgattgg
tttttggactccttccccatgcatcagaaagccagcgtttttacgcaagatcttctccgc
ttttatcaaaaaagcaaaatcctttatgaacatgaccatcgtgcacaatcatttgaatgg
attgatgtccataatgacgaacaatcaatcttttcttttattcgctatggcaaaaagcat
agtgaggcgcttgtcatcatttgtaattttacacccgcggtctatcatcaatatgatgtt
ggagttcctttttttacccaatacatcgaagtgctgaacagtgacagtgaaacatatgga
ggctcaggacaaatcaataaaaagccgttatcggccaaaaagggagctcttcatcataaa
ccttgttatatcacgatgaccatccccccttacggcatctcgattttacgggcggttaga
aaaagaggagagataaaaagatga

DBGET integrated database retrieval system