KEGG   Bacillus sp. JS: MY9_3238Help
Entry
MY9_3238          CDS       T02027                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bjs  Bacillus sp. JS
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MY9_3238
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MY9_3238
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MY9_3238
Enzymes [BR:bjs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MY9_3238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3178633..3179691)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEQLGIELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPNGKIAFGKLAQAVM
YGAEIIAIDGNFDDALKIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGEAPDVL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGAAAIVRNEVIENPETIATAIRI
GNPASWDKAVKAAEESDGKIDEVTDDEILHAYQLIAREEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDISEIKPVILPTDEESILEYIKGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggacttatccatcaatataaagaatttttacctgtaacagatcaaacaccg
gcgcttactttacatgaaggaaacacgcctcttattcacctgccgaagctgtctgagcag
ctcggaattgagcttcatgtcaaaacggagggcgtcaatcctactggatcatttaaagat
cgcggaatggttatggctgtggcgaaggcaaaagaagaaggcaatgacacaattatgtgc
gcgtcaacaggtaacacttccgctgctgcggcagcctatgcagcccgcgctaacatgaaa
tgcatcgtcattatcccgaacggaaaaattgcgtttggaaaactcgctcaagcagtcatg
tacggagccgagattatcgcaattgacggaaactttgacgacgcgcttaaaattgtccgt
tccatctgtgagaaatcaccgattgcccttgtcaactcagtcaacccttaccgcattgaa
ggccaaaaaactgctgccttcgaagtgtgcgaacagctgggggaagcgccggatgtgtta
gcgatcccagttggaaacgcgggaaatatcactgcgtactggaaaggcttcaaggaatat
catgagaaaaacggcacaggccttccaaaaatgcgcggctttgaagcggagggcgctgcg
gcaattgtgcgcaatgaagtgattgaaaatccggaaacaatagcgacggccattcggatt
ggaaacccggcaagctgggacaaagcggtaaaggcagccgaggaatccgatgggaaaatt
gacgaagttactgatgatgaaatccttcacgcctatcagctgattgcccgtgaagaaggc
gtgtttgcagaaccaggttcttgcgcgtctatcgcaggagtgctgaaacaggtgaaatcc
ggggaaattccgaaaggcagcaaggtcgtggctgtgttaacaggaaacggactgaaagat
ccgaacacagcggtcgacatttccgaaatcaagcccgtcatattgccgactgatgaagaa
agcatcctcgaatatataaaaggagcagcccgtgtatga

DBGET integrated database retrieval system