KEGG   Bacillus sp. JS: MY9_3650Help
Entry
MY9_3650          CDS       T02027                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bjs  Bacillus sp. JS
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MY9_3650
Enzymes [BR:bjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MY9_3650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3579589..3580437
Genome map
AA seq 282 aa AA seqDB search
MDLVVTSDKRPKAGETVLGTSFQTVPGGKGANQAVAAARLGAQVFMVGKVGDDHYGTAIL
NNLKANGVRIDYMEPVTHKESGTAHIVLAEGDNSIVVVKGANDDITPAYAIHALEQIEKV
DMVLIQQEIPEETVDEVCKYCHSHDIPIMLNPAPARPLKQETIDHATYLTPNEHEASLLF
PELTISEALALYPAKLFITEGKQGVRYSAGSKEVLIPSFPVEPVDTTGAGDTFNAAFAVA
LAEGKDIEAALRFANRAASLSVCSFGAQGGMPTRNEVEELLS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatttagtggtcacctcagacaaacgcccaaaagccggtgaaacggttcttggcacg
tcgtttcaaactgtgccgggcggcaaaggagcaaatcaggcggttgccgcagcaagactt
ggggctcaagtatttatggtcgggaaggttggagacgatcattatggaacagctattttg
aataacttaaaagcaaacggtgttcgcattgactatatggaaccggttacacacaaagaa
agcggaaccgcccacattgtgcttgctgaaggtgataacagcattgtcgttgtcaaaggc
gcgaacgatgacatcactccagcgtatgcgatacatgcgcttgaacagattgaaaaggtc
gatatggtcctgattcagcaggaaatcccagaggaaaccgttgatgaggtgtgcaaatac
tgccattcccacgatatcccgatcatgctaaacccggcaccggcccgcccgctgaagcag
gaaacaattgatcacgccacctatctcacgccgaatgaacacgaggcttcgctcttattc
cctgagcttaccatttctgaagccctggcgctttatccggcaaaactctttattacagaa
ggaaaacaaggcgtccgctattcagctggcagcaaagaggtgctcatcccgtccttccct
gttgagcccgtggatacaaccggagctggtgatacgtttaatgcagcgtttgccgtggct
ctggctgaaggaaaagacattgaagctgcattgcggtttgccaatcgtgctgcttccctt
tctgtctgttccttcggtgcccaaggcggcatgccgacaagaaatgaagtagaggagctg
ctgtcatga

DBGET integrated database retrieval system