KEGG   Bacillus sp. JS: MY9_4013Help
Entry
MY9_4013          CDS       T02027                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bjs  Bacillus sp. JS
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bjs00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bjs00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3902012..3902785)
Genome map
AA seq 257 aa AA seqDB search
MRKQVALVTGAAGGIGFEMAREFAREGASVIVSDLRQEACEKAASKLAEEGFDAAAIPCD
VTKEAQVADMVDAIQKRYGRLDILVNNAGIQHVAPIEEFPTETFELLIKVMLTAPFIAMK
HVFPIMKKQQYGRIINIASVNGLVGFAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNAL
CPGYVDTQLVRNQLSDLSKARNVPYDSVLEEVIFPLVPQKRLLSVKEIADYAVFLASEKA
KGVTGQAVVLDGGYTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacaagtcgccttggtgactggggctgccggcggaataggattcgaaatggca
agagaattcgcccgtgaaggcgccagcgtcatcgtttcagacctccgtcaggaagcatgc
gaaaaagcagcctccaaacttgcagaagaaggctttgacgcggcggccatcccgtgtgat
gtgacaaaggaagcgcaagttgctgatatggtggacgccatccaaaaacgatacggccgc
ttggatattttggtgaacaatgccggtatacagcacgtcgccccgattgaagagtttccg
acagaaacctttgaactgctgatcaaggttatgctgacggcgccctttattgcaatgaag
catgtttttccgatcatgaaaaaacagcagtatggcagaatcattaatatcgcgtctgtt
aatggcttagtcggttttgcgggaaaatccgcttataatagcgccaagcatggcgtcatt
ggactcacaaaagtcggggcgctggaaggcgcgccccacggcattacagtcaatgcgctc
tgtccgggttatgtcgatacccagcttgtccgcaatcagcttagcgatctatcaaaagca
agaaatgtcccttacgactcggtacttgaagaggtcatttttccgcttgtgccgcaaaaa
cggcttctttccgtcaaggaaattgcggattatgccgtgtttttagcaagcgagaaggcg
aagggcgtcactgggcaggctgtcgttcttgatgggggctacaccgcacaatga

DBGET integrated database retrieval system