KEGG   Bacillus sp. JS: MY9_4150Help
Entry
MY9_4150          CDS       T02027                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bjs  Bacillus sp. JS
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MY9_4150
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MY9_4150
   00030 Pentose phosphate pathway
    MY9_4150
   00051 Fructose and mannose metabolism
    MY9_4150
  Energy metabolism
   00680 Methane metabolism
    MY9_4150
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MY9_4150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4029556..4031481
Genome map
AA seq 641 aa AA seqDB search
MESKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDAKAALNEWYKETINRMIKLV
SYCSSKYTRSKLRKALPAQFAYITEELLYKTEQAGNKEQYYSEIIDQIIELGQADKLITG
LAYSVQRLVVDHLHVVGDIYDRGPQPDRIMEELINYHSVDIQWGNHDVLWIGAYAGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPAFRPKADDNRPEDEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDKNEITLHGKTYQLENTCFATVNP
EQPDELLEEEAEVINKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
NMETMMIDDKPYAGRELLDVFERFLREAFAHPEETDDLATDMAWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILAEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLQEVAILESLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagcaagtacctagatctactcgcgcaaaaatacgattgtgaagaaaaagtggta
acagaaatcattaatttgaaagcgatattgaacctgccaaagggcactgagcattttgtc
agtgatttgcacggggagtatcaggcattccagcacgtgctgcgcaatggttcaggacga
gtcaaagagaagatacgcgacatctttagcggtgtcatttacgatagagaaatcgatgaa
ttagcggcattggtctattatccggaagacaagctgaagttaatcaaacatgactttgat
gcgaaagcggcattaaacgagtggtataaagaaacgattaatcgaatgattaagctcgtt
tcttattgctcctccaagtatacccgctccaaactgcgcaaagcactgcctgcccagttt
gcttatattacggaggagctgctatacaaaacagaacaagctggcaacaaggagcaatat
tactccgaaatcattgatcagatcattgagcttggccaagccgataagctgatcaccggc
cttgcttacagcgttcagcggctggtggtcgaccatctgcatgttgtcggcgatatttac
gaccgcggaccgcagccagatagaattatggaagaactgatcaactatcattctgtcgat
attcagtggggaaatcacgatgtcctttggatcggcgcctatgccggttccaaagtgtgc
ctggccaatattatccgcatctgtgcccgctacgacaacctggatattattgaggacgtg
tacggcatcaacctgagaccgctgctaaacctggccgaaaaatattatgacgataatcca
gcgttccgtccaaaagcagacgacaacaggccagaggatgagattaagcaaatcaccaaa
atccatcaagcgattgcgatgatccaattcaagcttgagagcccgattatcaagagacgg
ccgaactttaatatggaggaacggctgttattagagaaaatagattatgacaaaaacgaa
atcacgctgcacggaaaaacatatcaactggaaaacacctgctttgcgacggtgaatccg
gaacagccagatgagctattagaggaagaagcagaagtcataaacaagctgctgttctct
gtccagcattccgaaaagctgggccgccatatgaattttatgatgaaaaaaggcagcctt
tatttaaaatataacggcaacctgttgattcatggctgtattcctgtcgatgaaaatggc
aatatggaaacgatgatgattgacgataaaccgtatgcgggccgtgagctgctcgatgta
tttgaacgattcttacgggaagcctttgctcacccggaagaaaccgatgacctggcgact
gatatggcctggtatttatggacaggcgagtactcctccctcttcggaaaacgcgccatg
acgacatttgagcgttatttcattaaagagaaggaaacgcataaagaaaagaaaaacccc
tattattatttacgcgaggacgaggcaacctgccgaaacatcctggcagaattcggcctc
aatccagatcatggccatatcatcaacggccatacacctgtaaaagaaatcgaaggagaa
gacccaatcaaagcaaacggaaaaatgatcgtcatcgacggcggcttctccaaagcctac
caatccacaacaggcatcgccggctacacgctgctatacaactcctacggcatgcagctc
gtcgcccataaacacttcaactccaaggcagaagtcctaagcaccggaaccgacgtctta
acggtgaaacgattagtggacaaagagcttgagcggaagaaagtgaaggaaacgaatgtg
ggtgaggaactgctgcaagaggttgcgattttggagagtttgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system