KEGG   Bacillus sp. JS: MY9_4159Help
Entry
MY9_4159          CDS       T02027                                 

Definition
hypothetical protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bjs  Bacillus sp. JS
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bjs01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bjs00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bjs00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4043075..4044301)
Genome map
AA seq 408 aa AA seqDB search
MGGMALTGNKAVVYKGKGNVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNI
CGSDQHMVRGRTTAPDGLVLGHEITGEVIDTGRDVEFIKKGDIVSVPFNIACGRCVMCKT
QKTHVCLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLT
MLSDIFPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQ
ARSFGCETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMD
VTQVGGSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLM
KAILSGRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaatggcgttgacaggaaacaaagcggttgtgtacaaaggcaaaggaaacgtg
gcggtggaggatatcggttatccggagttaatcttaagggacgggcccggcgtcccgaag
gcaaatgtgaatcgaaaatgtgagcatggggttattctcaaagtcattacaaccaacatt
tgcggaagcgaccagcatatggtcagaggccgcacaacggcgcctgatggcttggtgctc
gggcatgaaattactggagaagttattgatacggggcgggacgttgaatttatcaaaaaa
ggcgatatcgtatccgttccttttaatattgcctgcgggcgctgtgtgatgtgcaaaacg
cagaaaacgcacgtgtgcctgaatgtcaatcctgaccggccgggctcggcttacggctac
gtcgatatgggcggctgggtcggcggccagtctgaatacgtcatggtgccctacgctgat
tttcagcttttggtattccctgataaagaacaggcgttagaaaagattctcgatttgacc
atgctgtccgacattttcccgaccggcttccacggagcttacacagcgggcgtgcaaaca
ggttcaaccgtttatatcgcgggagcggggcctgtcggcttggctgctgcacactccgct
cagctcctaggggcctccaccgtgattgtcggcgatctgaacgaagatagactggcacag
gcgagaagcttcggctgtgaaacggtcaacgtgcaaaaacacgaccgccttggcgagcaa
attgaacaaatactaggtgaaccaaccgttgatgccgcagtggactgtgtcggctttgaa
gcatccgggcacggcaatcaaggagaagcgccagccgccgtgctgaactcgatcatggat
gtcacccaggtcggaggcagcctcggaattccgggcttatacgtgaccgaagatcccggt
gcaaaggatgcagacgccaaaacaggctcattaaaaatccgcttcggactcggctgggcc
aaagcccacactttcgtcaccggacaaacgccggcaatgacatacaaccgcaatttgatg
aaagcgatcctgagcggcagagcgcagatcgcaaaagcggtcaacgccaccgtcatttct
ctggacgacgcgccaaaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtc
atcgacccgcatgggacattgaagtaa

DBGET integrated database retrieval system