KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_03930Help
Entry
BJ6T_03930        CDS       T01848                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BJ6T_03930
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BJ6T_03930
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BJ6T_03930
Enzymes [BR:bju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BJ6T_03930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
410893..412053
Genome map
AA seq 386 aa AA seqDB search
MQSNPSHAPTHTHMASPELSQFRRIVVKVGSALLVDSDKGEVRASWLAALADDMAKLHRE
GRDVLVVSSGSIALGRSRLKLPRGPLKLEESQAAAAVGQIALARIWSEVLGAHGIGAGQI
LVTLQDTEERRRYLNARSTIGKLLEWRAIPVINENDTVATNEIRYGDNDRLAARVATMAS
ADLLVLLSDIDGLYDAPPKNNPNAKLIPVVDSISSEIEAVAGDAESELSRGGMRTKVEAA
KIATTGGTHMLIASGKIEHPLQAIADGGRCTWFLTPANPITSRKRWIAGTLEPKGTLTID
AGAVTALRAGASLLPAGVIKVEGQFARGDAVVVRGPDTSEVGRGLIAYDAEVAERIKGRS
SPDVMAILGISGRSEMIHRDDLVVGG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcaatccgtcacacgcgccaacacatacacacatggccagccccgaactcagt
caattccgccgcatcgtcgtcaaggtcggctccgccctgctggtcgattccgacaagggc
gaggtgcgcgcctcctggctcgccgcgctcgccgacgacatggccaagctgcatcgcgag
ggacgcgatgtgctcgtcgtctcctccgggtcgatcgcgctcggccgcagccgcctcaag
ctgccgcgcggcccgctgaagctggaggagagccaggccgccgccgccgtcggccagatc
gcgctggcgcggatctggtcggaggtgctcggcgcccacggcatcggcgcggggcagatc
ctggtcacgctccaggacaccgaggagcgccgccgctatctcaacgcgcgctccaccatc
ggcaagctgctggaatggcgcgcgatccccgtcatcaacgagaacgacacggtcgccacc
aacgagatccgctacggcgacaatgaccgcctcgccgcgcgcgtcgccaccatggcgagc
gccgatttgctggtgctgctgtccgatatcgacgggctctacgacgccccgccgaagaac
aacccgaacgcaaaactcattcccgtggtcgacagcatctcctcggaaatcgaggccgtg
gcaggcgacgccgagtccgagctgtcgcgcggcggtatgcgcaccaaggtcgaggccgcc
aagatcgcgaccacaggcggcacacatatgctgatcgcctccggcaagatcgagcatccc
ctgcaggctatcgccgacggcggccgctgcacctggttcctgacgccggccaaccccatc
acctcgcgcaagcggtggatcgcaggcacgctcgagccgaaaggcacgctgaccatcgat
gccggcgccgtgacggcgctgcgtgccggggccagcctgctgccggccggcgtgatcaag
gtggaaggccagttcgcccgcggcgatgccgtggtcgtgcgcggtcctgataccagcgag
gtcggccgcggcctgatcgcctacgatgccgaggtcgccgagcggatcaagggccgctcg
tccccggacgtgatggcgatcctcggcatcagcgggcggtccgagatgatccaccgcgac
gatctggtggtgggcgggtaa

DBGET integrated database retrieval system