KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_04240Help
Entry
BJ6T_04240        CDS       T01848                                 

Definition
succinyl-CoA synthetase beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BJ6T_04240
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJ6T_04240
   00640 Propanoate metabolism
    BJ6T_04240
   00660 C5-Branched dibasic acid metabolism
    BJ6T_04240
Enzymes [BR:bju01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BJ6T_04240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(446150..447346)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKALLNEFGVAISKGVPVLKPADAEAAAKALPGPVWVVKSQIHAGGRGKGKFK
EASAGDKGGVRIAKSAAEVAEFAKQMLGATLVTVQTGPAGKQVNRLYIEDGSDIDKEFYL
SILVDRETSRVSFVVSTEGGVNIEDVAHNTPEKIVTFSVDPATGIMGHHGRTVANALKLS
GDLAKQAEKLTAQLYTAFVAKDMSMLEINPLVVTKQGQLRVLDAKVSFDDNALFRHPEVL
ALRDETEEDAKEIEASKYDLNYVTLDGNIGCMVNGAGLAMATMDIIKLYGMSPANFLDVG
GSASKEKVAAAFKIITADPNVKGILVNIFGGIMKCDVIAEGVTAAVREVGLSVPLVVRLE
GTNVELGKKIIRESGLNVVPADNLDDAAQKIVKAVKGG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaatatcaagccaaagcgctgctgaacgagttcggcgtcgcgatctcg
aagggcgtccccgtcctgaagcccgcggacgcggaagccgccgccaaggccctcccgggt
ccggtctgggtggtgaagagccagatccacgccggtggccgcggcaagggcaagttcaag
gaagcctcggccggcgacaagggcggcgtccgcatcgccaaatcggccgccgaggtcgcc
gaattcgccaagcagatgcttggcgccacgctcgtgaccgtgcagaccggccccgccggc
aagcaggtcaaccgcctctacatcgaggacggctcggacatcgacaaggagttctacctc
tcgatcctggtcgaccgcgagacctcgcgcgtgtcgttcgtggtgtcgaccgaaggcggc
gtcaacatcgaggacgtcgcgcacaacacccccgagaagatcgtcaccttctcggtcgat
cccgcgaccggcatcatgggccatcacggccgcaccgtcgccaacgcgctgaaactctcc
ggcgatctcgccaagcaggccgagaagctcaccgcgcagctctacaccgccttcgtcgcc
aaggacatgtcgatgctggagatcaacccgctggtcgtgaccaagcagggccagctccgc
gtgctcgacgccaaggtgtcgttcgacgacaacgcgctgttccgtcaccccgaggtgctc
gcgctgcgcgacgagaccgaggaagacgccaaggaaatcgaggcgtcgaaatacgacctc
aactacgtcaccctcgacggcaatatcggctgcatggtcaacggcgccggtctcgcgatg
gcgacgatggacatcatcaagctctacggcatgtcgccggcgaacttcctcgacgtcggc
ggcagcgccagcaaggagaaggtcgcggccgcgttcaagatcatcaccgccgatcccaac
gtgaagggcatcctggtcaacatcttcggtggcatcatgaagtgcgacgtgatcgccgaa
ggcgtcacggccgccgtgcgcgaggtcggcctcagcgtgccgctggtggtccgcctcgaa
ggcaccaatgtcgagctcggcaagaagatcatccgcgaatccggcctgaacgtggtgccg
gccgacaatctcgacgacgccgcgcagaagatcgtgaaggccgtcaagggaggctga

DBGET integrated database retrieval system