KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_04280Help
Entry
BJ6T_04280        CDS       T01848                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BJ6T_04280
Enzymes [BR:bju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BJ6T_04280
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BJ6T_04280
Lipid biosynthesis proteins [BR:bju01004]
 Fatty acid synthase
  Component type
   BJ6T_04280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(450903..451646)
Genome map
AA seq 247 aa AA seqDB search
MVSGAVPASKEVSMRLSMVRSYGNSAYAVERRYGFFMHIAVLMFALMTAVDPAWAEAAKP
VKLVVLGDSLSAGLGLPAQDAFPTKLQKALQAKGIAVDMTNAGVSGDTSSGGRDRLDWSV
PDGTDGVIIELGANDALRGIDPDLTRTALTDIVQRLKARKIAVMLCGMLAPPNYGAEYAA
RFNSIYPDLAKKFDVPLYPFFLDGVAADAKLNQADGIHPTAAGVDIIVNNIMPTVEAFLR
NISEQRR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccggcgcggtgccggcgagcaaagaggtttcgatgcgactgtccatggtccgg
tcatatggcaactccgcatacgcggtcgagaggcgttacggattcttcatgcacatagcc
gtgttgatgttcgctttgatgacggcggtggatccggcatgggccgaagcggcaaagccg
gtcaagcttgtcgttctcggcgattccctgagcgccggcctcggtctcccggcccaggac
gcattccccacaaaacttcaaaaagccttgcaggccaaaggcatagctgtcgatatgacc
aatgccggcgtgtccggcgacacctcgtccggcggccgtgaccggctcgactggtcggtc
ccggacggaaccgacggcgtgatcatcgagctcggcgccaacgacgcgctgcgcggcatc
gaccctgacctgacgcgcaccgcgctgaccgacatcgtccagcgattgaaggcacgcaag
atcgcggtgatgctgtgcggcatgctggcgccgccgaattacggcgcggaatacgccgcg
cgcttcaattcgatttatccggatcttgcgaaaaaattcgacgtgccgctctatccgttc
ttcctcgatggtgtcgcggccgacgccaagctcaaccaggccgacggcattcatccgacc
gcggccggcgtcgacatcatcgttaacaacatcatgcccaccgtggaggcatttttgcgc
aacataagcgagcagcgccgctga

DBGET integrated database retrieval system