KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_04830Help
Entry
BJ6T_04830        CDS       T01848                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:bju01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bju00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bju00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:bju00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502382..502786
Genome map
AA seq 134 aa AA seqDB search
MSTADTPKRSMRTPLGRVRNLGAAHSGTSDFWRQRLTAVAMVLLMIPVIVVIMMLLGRNQ
AYAKQILGSLPIAIIMVLFIVASAWHMKIGMQVVIEDYIHNEKLKLATIMLNNFFSIAVA
LASIYAILQLSSGV
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggccgatacgccgaagcgcagcatgcgcaccccgctcggccgcgtccgcaac
cttggcgcggcgcattccggcacgtccgatttctggcgccagcgcttgactgcagtggcg
atggtcctgctgatgatccccgtgatcgtcgtcatcatgatgctgctcggccgcaaccag
gcctatgccaagcagatcctcggctcgctgccgatcgccatcatcatggtgctcttcatc
gtcgccagcgcctggcacatgaagatcggcatgcaagtcgtgatcgaggactatatccac
aacgagaagctgaagctcgcgacgatcatgctcaacaatttcttctcgatcgcggtcgcg
ctcgcctcgatctacgcgattctccaactgtcatccggagtgtaa

DBGET integrated database retrieval system