KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_05370Help
Entry
BJ6T_05370        CDS       T01848                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BJ6T_05370
Enzymes [BR:bju01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BJ6T_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(558430..559191)
Genome map
AA seq 253 aa AA seqDB search
MSILVTRPHPDNEATAKNLRARGHAVLLAPMLKFEPVAFHDESEADYGAIIVTSANAIRA
VAPQLQALGLKNLGLFELPLFAVGEHTAAAARDAGFAEVIVAGGDAAALRDKVMRSARDK
LLKKKGTLLYLAGADLSRDLGAELGAEGFSVVTQTTYRMTPVKILPRDVCDGFAAHGIEA
VLHYSRRSARAFLDAARDEGVEISALAIPQCCLSETVASVLRDAGASQVLGAATPDENAL
FDTLERALRTRLA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtccattcttgtcacacggccgcatcccgacaatgaggcgacggcgaaaaatttgcgg
gcgcggggtcatgcggtgctgctcgccccgatgctcaagttcgagccggtcgccttccat
gacgagagtgaggccgactacggcgccatcatcgtcacgtcggccaatgcgatccgcgcc
gtcgcgccgcaattgcaggcccttggcttaaagaaccttggccttttcgagctgccgctg
tttgcggtcggcgagcacacggctgccgcggcgcgcgacgccggcttcgccgaggtgatc
gtcgccggcggcgatgccgcggccttgcgcgacaaggtgatgcggagcgcacgcgacaag
ctgctgaagaagaaaggcacgctgctctatctcgcgggcgcggatctgtcgcgcgatctc
ggcgccgagctcggcgccgagggcttcagcgtggtgacgcagaccacctatcgcatgact
ccggtcaagatactgccgcgcgatgtctgcgatggctttgccgcgcatgggatcgaggcg
gtgctgcactactcccgtcgcagcgcgcgggccttcctggatgcggcacgagacgaaggc
gtcgaaatctcggcgctggcgatcccgcaatgctgcctgtccgagacggtcgccagcgtg
ctgcgcgatgccggtgcgtcgcaggttctgggggccgcgacgccggacgaaaatgcccta
tttgataccttggagcgtgctttgcggacccgtttggcgtaa

DBGET integrated database retrieval system