KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_05940Help
Entry
BJ6T_05940        CDS       T01848                                 

Definition
(RefSeq) hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
bju  Bradyrhizobium japonicum USDA 6
Brite
Enzymes [BR:bju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     BJ6T_05940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(614444..615490)
Genome map
AA seq 348 aa AA seqDB search
MESGFDDLDYDYAASIAGRAVRSMAEQRIPPTPTNFAVWFHYFAGSHDDLRNAIELLIDH
NRPFDARTNQDLFETYVAPRAGTVASETSDRLHALMGAAKEFLATAMADNHSQMRAISEV
ADRGRAGVDPKALVAQLMNELARAATRATRLEAGFAEKTRELDVIRDSLSKSEERARTDT
LTGLANRRALDEFLRKAQTTADWGEPLGVLMLDIDHFKTFNDNFGHGVGDQMLRLIAKVL
REKVREQDLPARYGGEELIAVLPDADLATCAEIAERIRRAIVECTITRRSTGETLPNISV
SIGVAQYRTGEAITDLIERCDRALYLAKGGGRNRMVTEVELDRATAAR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaggcttcgacgatctcgattacgactatgccgcgtccatcgccggacgggcg
gtgcggagcatggccgagcagcggattccgccgacgccgaccaattttgccgtctggttc
cactatttcgcaggcagccatgacgatttgcgcaatgccatcgaactcctgatcgaccac
aatcgccccttcgacgccaggaccaaccaggatctgttcgagacctatgtcgcgccccgg
gcgggcaccgtcgcctccgagacgtccgatcggctgcatgccctcatgggggcagcgaag
gagtttctggcgacggccatggccgacaatcattcccagatgcgggcgatcagcgaggtc
gccgatcggggcagggccggcgtcgatccgaaggcgctggtcgcccagctcatgaacgag
ctggcgcgggcggccaccagggcgaccaggctcgaggctggctttgccgaaaagacccgc
gagctcgacgtgatccgcgactcgctctccaagtccgaggagcgcgcccggaccgatacg
ctgacggggctggcaaaccggcgggcgctcgatgaattcctgcgcaaggcacagacgacc
gcggattggggcgagccgctcggcgtgctgatgctcgacatcgaccacttcaagaccttc
aacgacaatttcggccatggtgtcggcgaccagatgctgcgcctgattgcgaaagtgctg
cgcgaaaaagttcgcgagcaggatttgccggcccgctatggcggcgaggagctgatcgcg
gtgctgccggatgccgatctcgccacttgcgccgagatcgccgagcgcatcaggcgcgcc
atcgtcgaatgcacgatcacgcgccgctcgaccggggagaccctgcccaacatcagcgtg
tcgatcggcgtagcgcagtaccggaccggcgaggcgatcaccgatctcatcgagcgctgc
gaccgcgcgctctatctcgccaagggcggcggtcgtaatcgcatggtgacggaggtcgag
ctcgatcgcgctacggctgcccgctag

DBGET integrated database retrieval system