KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_06440Help
Entry
BJ6T_06440        CDS       T01848                                 

Gene name
grpE
Definition
bifunctional pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bju00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(665305..666027)
Genome map
AA seq 240 aa AA seqDB search
MFDRRQILAALGTSALVALAPTALLAAASIKPDDASALLVIDVQNCFLPGGSLAVKEGEQ
VVPVINKMAKAFANVVMTQDWHTPGHISFASVHSGKKPFETVDLPYGKQVLWPDHCVQGT
DGAALSKDLAIPHAELIIRKGFHKDVDSYSAFLEADGKTSTGLAGYLKGRKIKRVFVAGL
ATDFCVAWTALDARKAGFEVYVVEDACRGIDTQGSLAKAWADMAKAGVKRIQSTDIAVSA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatcgacgacaaatcctcgcggcgcttgggacaagcgctctcgtagcccttgct
ccaaccgcgctccttgcggccgcatcgatcaagccggacgatgcctccgcgctgctcgtg
atcgacgtgcaaaactgcttcctgcccggcggcagcctcgccgtgaaggaaggcgagcag
gtcgttcccgtcatcaacaagatggcgaaagcgtttgcgaacgtggtgatgacccaggac
tggcacacaccaggccacatttcgtttgcgtcggtgcactccggcaagaagccgttcgag
accgtcgaccttccctacggcaagcaggtgctgtggcccgaccattgcgtgcagggcacc
gatggcgccgcgctgtcgaaggatctcgcgatcccgcatgccgagctcatcatccgcaag
ggttttcacaaggacgtcgacagctattcggccttcctggaagccgacggcaagacctcg
accggcctcgccggctacctgaagggccgcaagatcaagcgcgtcttcgtcgccggcctc
gcgacagacttctgcgtcgcctggaccgcactcgatgcgcgcaaggcgggcttcgaggtc
tatgtggtggaggacgcctgccgcggcatcgacacgcagggttcgctggcaaaagcctgg
gccgacatggccaaggccggcgtgaagcggattcagtccacggatatcgcggtgagcgcc
tga

DBGET integrated database retrieval system