KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_07420Help
Entry
BJ6T_07420        CDS       T01848                                 

Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00260  Glycine, serine and threonine metabolism
bju00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bju01100  Metabolic pathways
bju01110  Biosynthesis of secondary metabolites
bju01130  Biosynthesis of antibiotics
bju01230  Biosynthesis of amino acids
Module
bju_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BJ6T_07420
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BJ6T_07420
Enzymes [BR:bju01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BJ6T_07420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAL06035
UniProt: G7DIZ7
Position
772728..773945
Genome map
AA seq 405 aa AA seqDB search
MNIAKPNSYRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYTAAKADPAFQAEMNGYLK
NYVGRPSPLYFAERLTEHLGGAKIYLKREELNHTGSHKVNNVLGQIMLARRMGKKRIIAE
TGAGQHGVATATLCARFGLECVVYMGAVDVERQQPNVIRMEMLGATVVPVQSGTRTLKDA
MNEALRDWVTNVHNTFYCIGTVAGPHPYPTLVRDFQSIIGNETKTQMQEVEGRLPDSLVA
CIGGGSNAMGLFHPFLDDPSVEIFGVEAAGHGLTQLHAASIAGGRPGVLHGNRTYLLMDA
DGQIQDAHSISAGLDYPGIGPEHSWLHEIGRVNYLSATDDEALAAFQLLSRLEGIIPALE
PAHAIAKVMELAPKRPRDHLMVVNLSGRGDKDVPQVGDILRGKNK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgccaaaccaaattcctaccgcagcggtcccgacgagcgcgggcacttcggc
attttcggcggccgcttcgtcgccgaaaccctgatgccgctgatcctcgatctcgagaag
gcctacacggcggccaaggccgatccggcgttccaggccgagatgaacggctatctcaag
aactatgtcggccggccttcgccgctctatttcgccgagcgcctcaccgagcatctcggc
ggcgccaagatttacctcaagcgcgaagagctcaaccacaccggttcgcacaaggtgaac
aatgtgctcggccagatcatgctggcgcggcgcatgggcaagaagcgcatcatcgccgag
accggtgccggccagcacggcgtcgccaccgcaacgctgtgcgcgcgcttcggcctcgaa
tgcgtggtctatatgggcgccgtcgacgtcgagcggcagcagcccaatgtcatccgcatg
gagatgctgggcgcgacggtggtcccggtgcagtcgggcacgcgcacgctgaaggacgcc
atgaacgaggcgctgcgcgactgggtcaccaacgtgcacaacacgttctattgcatcggc
acggtggcgggcccccatccctatccgacgctggtgcgcgacttccagtcgatcatcggc
aacgagaccaagacgcagatgcaggaggtcgagggccgcctgccggattcgctggtcgcc
tgcatcggcggcggctcgaacgcgatgggcctgtttcatccgttcctcgacgatccctcc
gtcgaaatcttcggcgtcgaagccgccggccatgggctcacgcaattgcatgcggcctcg
atcgcgggcggccgtcccggcgtgctgcacggtaaccgcacttatctcttgatggatgcg
gacggccagatccaggacgcgcattcgatctccgccggccttgactatcccggcatcggc
cccgagcattcctggctgcacgagatcggccgcgtcaactatctctccgcgaccgatgac
gaggcgcttgcggcattccaattgctgtcgcggctcgaaggcatcatccccgcgctcgag
cccgcgcatgccatcgccaaggtgatggagctcgcgccgaagcggccgagagatcacctg
atggtcgtcaatctctccggccgcggcgacaaggacgtcccgcaggtcggcgacatcctg
aggggcaagaacaagtga

DBGET integrated database retrieval system