KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_07620Help
Entry
BJ6T_07620        CDS       T01848                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:bju00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    BJ6T_07620
Enzymes [BR:bju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     BJ6T_07620
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     BJ6T_07620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797844..798743
Genome map
AA seq 299 aa AA seqDB search
MPELPEVETVRRGLQPVMEGAKILVAEARRPDLRFPFQPDFVARLQGQVVTGLGRRAKYL
MADLASGDVLLMHLGMSGSFRVIKPDNEAAPGEFHYPRGKDSTHDHVLFRMSSGADIVFN
DPRRFGYMKVIARKVLEDEPLLRDLGPEPLGNEFDAAMLARSCEGKTTSLKAALLDQRVV
AGLGNIYVCEALHRSHLSPRRIAATLATKGRKSVGGSEPTDHAKRLVSAIHTVLNDAIKA
GGSSLRDHRQTSGELGYFQHSFKVYDREGETCKTPGCGGTIKRFTQNGRSTFWCAKCQK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgcccgaagtcgagaccgtccgccgcggccttcagcccgtcatggagggt
gcgaaaatcctcgtcgcggaggcccgcaggccggatctgcgctttcccttccagcccgat
ttcgtggcccggctccaggggcaggtcgtcacggggcttggccgccgtgcaaaatatctc
atggccgatctcgcctccggcgacgtgctgctgatgcatctaggcatgtcgggctcgttc
cgcgtcatcaagccggacaacgaggccgcgccgggcgagtttcactacccgcgcggtaag
gactccacgcacgaccacgtgctgtttcggatgtcctccggcgccgacatcgtgttcaac
gacccgcgccgcttcggttacatgaaagtgatcgcgcgcaaagtgcttgaggacgagccg
ctgctgcgcgatctcggtcccgagccgctcggcaacgaattcgacgccgcgatgctggcg
cggtcgtgcgagggcaagacgacgagcctgaaggccgcgctactcgaccagcgcgtggtc
gccgggctcggcaacatctatgtctgcgaagcgctgcatcgctcgcatctgtcgccgcgt
cgcattgctgcgacgctcgcgaccaagggtcgcaagagtgttggcggcagcgagccgacc
gatcatgcgaagcggctggtgagtgccattcacaccgtgctcaacgacgcgatcaaggcc
ggcggctccagcttgcgcgaccatcgccagacctcgggcgaactcggctatttccagcat
tccttcaaggtctatgaccgcgagggcgagacctgcaagacgccagggtgcggcggcacg
atcaagcgcttcacccagaacggccgttccaccttctggtgtgcgaaatgtcagaagtga

DBGET integrated database retrieval system