KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_07620Help
Entry
BJ6T_07620        CDS       T01848                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bju03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797844..798743
Genome map
AA seq 299 aa AA seqDB search
MPELPEVETVRRGLQPVMEGAKILVAEARRPDLRFPFQPDFVARLQGQVVTGLGRRAKYL
MADLASGDVLLMHLGMSGSFRVIKPDNEAAPGEFHYPRGKDSTHDHVLFRMSSGADIVFN
DPRRFGYMKVIARKVLEDEPLLRDLGPEPLGNEFDAAMLARSCEGKTTSLKAALLDQRVV
AGLGNIYVCEALHRSHLSPRRIAATLATKGRKSVGGSEPTDHAKRLVSAIHTVLNDAIKA
GGSSLRDHRQTSGELGYFQHSFKVYDREGETCKTPGCGGTIKRFTQNGRSTFWCAKCQK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgcccgaagtcgagaccgtccgccgcggccttcagcccgtcatggagggt
gcgaaaatcctcgtcgcggaggcccgcaggccggatctgcgctttcccttccagcccgat
ttcgtggcccggctccaggggcaggtcgtcacggggcttggccgccgtgcaaaatatctc
atggccgatctcgcctccggcgacgtgctgctgatgcatctaggcatgtcgggctcgttc
cgcgtcatcaagccggacaacgaggccgcgccgggcgagtttcactacccgcgcggtaag
gactccacgcacgaccacgtgctgtttcggatgtcctccggcgccgacatcgtgttcaac
gacccgcgccgcttcggttacatgaaagtgatcgcgcgcaaagtgcttgaggacgagccg
ctgctgcgcgatctcggtcccgagccgctcggcaacgaattcgacgccgcgatgctggcg
cggtcgtgcgagggcaagacgacgagcctgaaggccgcgctactcgaccagcgcgtggtc
gccgggctcggcaacatctatgtctgcgaagcgctgcatcgctcgcatctgtcgccgcgt
cgcattgctgcgacgctcgcgaccaagggtcgcaagagtgttggcggcagcgagccgacc
gatcatgcgaagcggctggtgagtgccattcacaccgtgctcaacgacgcgatcaaggcc
ggcggctccagcttgcgcgaccatcgccagacctcgggcgaactcggctatttccagcat
tccttcaaggtctatgaccgcgagggcgagacctgcaagacgccagggtgcggcggcacg
atcaagcgcttcacccagaacggccgttccaccttctggtgtgcgaaatgtcagaagtga

DBGET integrated database retrieval system