KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_08270Help
Entry
BJ6T_08270        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bju00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bju00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(870322..871617)
Genome map
AA seq 431 aa AA seqDB search
MAPIQYIVEGGHRLSGSIEPSGNKNSALPIIAAALLTEHPVTLENVPRIRDTETLVELIR
SVGAAAEWTARNTLHIHAKSIRAADLDPELCVRIRASILLAGPLLARCGEVMLPPPGGDV
IGRRRLDTHVLALEQLGAKVTATDRLEFRAAKLAGADVFLDEPSVTATENALVAAVAADG
VTHLRNAASEPHVQDLANFLVALGARIEGIGTNTMIVHGPATLGATTYRIQPDHIEVGSL
IGLAAVTRSPLRIVRAGVEHLRSIRMGFERLGIVCRIEGDDLIVPSNQTLKIQDDFGGHV
PKLEDQPWPAFPADLMSIAIVTATQCDGVILMFEKMFESRMFFVDKLIAMGARIVLCDPH
RAIIAGPSRLRGASMISPDIRAGMAMLLAAVCAEGTSTINNADQIERGYERIDERLNALG
AKIRRVPERKG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcccatccagtacattgtcgagggcggtcaccggctctcgggctcgatcgagccg
tccggcaacaagaattcggcgctgccgatcatcgcagccgccctgctcaccgagcatccg
gtgacgctggagaacgtgccgcggatccgcgacaccgagacgctggtcgagctgatccgc
tcggtcggcgcggcggcggaatggaccgcccgcaacacgctgcacatccacgccaagagc
atccgcgccgccgacctcgaccccgagctctgcgtgcgcatccgcgcctcgatcctgctc
gcgggccccctgctcgcccgctgcggcgaagtgatgctgccgccgcccggcggcgacgtc
atcggccgccgccgcctcgacacccatgtgctcgcgctcgaacaactgggcgccaaggtc
accgccaccgaccggctcgaattccgcgcggcaaagctcgccggtgctgacgtgttcctg
gacgagccgagcgtcaccgcaaccgaaaacgcgctggtcgcagccgtcgcagccgacggc
gtcacccatttgcgcaacgcggcctccgagccgcatgtgcaggacctcgccaatttcctg
gtcgcgctcggcgcgcgaatcgagggcatcggcaccaacaccatgatcgtgcatgggccg
gcgacgctgggcgccacgacctaccggatccagcccgaccatatcgaggtcggctcgctg
atcgggcttgcggctgtcacgcgctccccgcttcgcatcgtgcgcgccggcgtcgagcat
ctgcgctcgatccgcatgggattcgagcggctcggtatcgtctgccgcatcgagggcgac
gatctcatcgtgccctcgaaccagacgctgaagatccaggacgatttcggcggccacgtg
ccgaagctggaagaccagccctggccggccttcccggccgatctgatgtcgatcgcgatc
gtcaccgccacgcaatgcgacggcgtgatcctgatgttcgagaagatgttcgaatcgcgg
atgttcttcgtcgacaagctgatcgccatgggggcgcgaattgttctctgtgatccgcat
cgcgccatcatcgccggccccagccgcctgcgcggcgcatcgatgatctcgcccgacatc
cgcgccggcatggcgatgctgctcgccgcggtctgcgccgagggcacctccacgatcaac
aacgccgaccagatcgagcgcggctacgagcgcatcgacgaacgcctgaacgcgctcggc
gcgaagatcaggcgcgtgcctgaaaggaagggctga

DBGET integrated database retrieval system