KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_11520Help
Entry
BJ6T_11520        CDS       T01848                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bju00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bju00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229959..1231281
Genome map
AA seq 440 aa AA seqDB search
MNAPAKFFDASAPVAFGGNDAGNTPAFRWYDKDRLVHGRRLEDHLRFAVCYWHSFCWPGG
DPFGGETFLRPWHQGADAMAQARAKADVAFELFRLLDVPFFTFHDVDAAPEGTSLSESVA
NLNAIADLFEAKMASAKVRLLWGTANLFTHRRYMAGAATNPDPEIFTYAAGQVRAALEVT
HRLGGQNYVLWGGREGYETLLNTDLKRELDQLGRFVSLVVEHKHKIGFKGPILIEPKPKE
PTKHQYDFDVATCYGFLERYDLLNDVKLNIEQNHAILAGHSFHHEVALAEALGIFGSLDV
NRGDDLLGWDTDQFAMNVPELALVFHEILNRGGFTSGGLNFDAKIRRQSIDPDDLIHAHV
GSMDACARAFLAAADMLDAGALTAPLAQRYEGWAEPEGRAILGGQRSLSELADRALSAGF
DPRPRSGRQEYLESLVNRYV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgccagccaaattcttcgatgcaagcgcccctgtcgccttcggcggcaatgat
gcgggaaacacgcccgccttccgctggtacgacaaggaccggctcgtgcatggccgcagg
ctcgaggatcatctgcgctttgcggtctgctactggcattcgttctgctggccgggcggc
gatcccttcggcggcgagacctttctgcgcccctggcatcaaggtgccgatgcgatggcg
caggcacgcgccaaggccgatgtcgctttcgagctgttccgcctgctggacgtgcccttc
ttcactttccacgacgtcgatgcggctccggaaggcacttcgctcagcgagtccgtcgcc
aatctcaatgcgatcgccgatctgttcgaagcgaagatggcctccgcaaaagtccgcttg
ctctggggcacggccaatttgttcacgcatcgccgctacatggcgggcgccgcgaccaat
ccggaccccgaaatcttcacctatgccgccggccaggtccgcgccgcgctggaggtgacg
caccggctcggcggccagaactatgtgctgtggggcggccgcgagggctacgagacgctg
ctcaacaccgatctcaagcgcgagctcgaccagctcggccgcttcgtctcgctggtcgtc
gagcacaagcacaagatcggcttcaagggcccgatcctgatcgagccgaagccgaaggag
ccgaccaagcatcaatatgatttcgacgtcgccacctgctacggcttcctggaacgctac
gacctcctgaacgacgtcaagctcaacatcgagcagaaccacgccattcttgccggccac
tccttccatcacgaggtcgcgctcgccgaggcgctcggcatcttcggctcgctcgacgtc
aatcgcggcgacgatctgctcggctgggacaccgaccagttcgcgatgaacgtgccggag
ctggctctggtgttccacgagatcctgaatcgcggcggcttcacctcgggcgggctcaat
ttcgacgccaagatcaggcggcagtcgatcgaccccgacgatctgatccatgcccatgtc
ggctcgatggatgcctgcgcgcgcgcgttcctcgccgccgccgacatgctcgatgccggc
gccctcaccgcgccgctcgcgcagcgctacgaggggtgggcggaacccgagggccgggcc
attctcggcggccagcgctcgctctccgaacttgccgaccgcgcgctcagcgccggcttc
gacccgcggccgcgctcggggcggcaggaatatctggaatccctggtcaaccgctacgtc
tga

DBGET integrated database retrieval system