KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_12060Help
Entry
BJ6T_12060        CDS       T01848                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bju00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BJ6T_12060 (recR)
DNA repair and recombination proteins [BR:bju03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BJ6T_12060 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1289232..1289834
Genome map
AA seq 200 aa AA seqDB search
MGSVAGPEIERLVQLLARLPGLGPRSARRAALHLIKKREALMMPLSSALQVALDKVQVCK
TCGNIDTQNPCTVCTDPKRDPAIIVVVADVADLWALERANATQGRYHVLGATLSPLDGVG
PQDLTIDALVARAHAAEVHEIILALNATVDGQTTAHYITDLLQDANVKVTRLAHGVPVGG
ELDYLDEGTLSAAMRQRTLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggttgcaggtcccgaaatcgagcggctggtccagcttctcgcacggctgccg
ggcttgggcccgcgctccgcgcggcgtgcggcgctgcatctgatcaagaagcgcgaagcg
ctgatgatgccgctgtcttcggcgctgcaggtcgcgctcgacaaggtccaggtctgcaag
acctgcggcaacatcgacacgcaaaatccctgcaccgtctgcaccgatccgaagcgcgat
cccgcaatcatcgtcgtggtcgccgatgtcgccgacctctgggcgctggagcgggccaat
gcgacccagggccgctatcacgtgctgggcgcgaccttgtcgccgctcgacggcgtcggc
ccgcaggatctcaccatcgacgcgctggtcgcgcgcgcgcatgctgccgaggtgcatgag
atcatcctggcgctgaacgcgacggtcgacggccagaccacggcgcactacatcaccgac
ctgcttcaggacgccaacgtaaaagtaacccggctggcccatggtgtgccggtcggtggc
gagcttgattatctcgacgaaggtacgctatcggccgccatgcggcagcggaccctgttc
tag

DBGET integrated database retrieval system