KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_12060Help
Entry
BJ6T_12060        CDS       T01848                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bju03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1289232..1289834
Genome map
AA seq 200 aa AA seqDB search
MGSVAGPEIERLVQLLARLPGLGPRSARRAALHLIKKREALMMPLSSALQVALDKVQVCK
TCGNIDTQNPCTVCTDPKRDPAIIVVVADVADLWALERANATQGRYHVLGATLSPLDGVG
PQDLTIDALVARAHAAEVHEIILALNATVDGQTTAHYITDLLQDANVKVTRLAHGVPVGG
ELDYLDEGTLSAAMRQRTLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggttgcaggtcccgaaatcgagcggctggtccagcttctcgcacggctgccg
ggcttgggcccgcgctccgcgcggcgtgcggcgctgcatctgatcaagaagcgcgaagcg
ctgatgatgccgctgtcttcggcgctgcaggtcgcgctcgacaaggtccaggtctgcaag
acctgcggcaacatcgacacgcaaaatccctgcaccgtctgcaccgatccgaagcgcgat
cccgcaatcatcgtcgtggtcgccgatgtcgccgacctctgggcgctggagcgggccaat
gcgacccagggccgctatcacgtgctgggcgcgaccttgtcgccgctcgacggcgtcggc
ccgcaggatctcaccatcgacgcgctggtcgcgcgcgcgcatgctgccgaggtgcatgag
atcatcctggcgctgaacgcgacggtcgacggccagaccacggcgcactacatcaccgac
ctgcttcaggacgccaacgtaaaagtaacccggctggcccatggtgtgccggtcggtggc
gagcttgattatctcgacgaaggtacgctatcggccgccatgcggcagcggaccctgttc
tag

DBGET integrated database retrieval system