KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_13280Help
Entry
BJ6T_13280        CDS       T01848                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BJ6T_13280
  Amino acid metabolism
   00340 Histidine metabolism
    BJ6T_13280
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BJ6T_13280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1406565..1407860
Genome map
AA seq 431 aa AA seqDB search
MPVRLDRSSADFDQRFAAFLAAKREVSADVEAAVRVIVDDVAKRGDAALLEATAKFDRLK
LDASGLRVSAAEIETAVKACDAATLDALKLARDRIETYHRRQLPKDERFTDPLGVELGWR
YTAIESAGLYVPGGTAAYPSSVLMNAVPAKVAGVARLVMVVPSPDGKLNPLVLAAASLGG
VSEIYRVGGAQAVAALAHGTATIAPVAKIVGPGNAYVAAAKRLVFGKVGIDMIAGPSEVL
VIADDTGNADWIAADLLAQAEHDASAQSILITDSARLATDVEKAVEAQLKTLPRTAIAGA
SWADFGAIIMVKNLADAIPLADAIAAEHLEIMTDDPDALAAKIRNAGAVFLGAHTPEAIG
DYVGGSNHVLPTARSARFSSGLGVADFMKRTSILKCGPDQLRALGPAAMTLGQAEGLDAH
SRSIGLRLNLS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttcgtctcgaccgcagcagcgccgattttgaccagcgattcgcggccttcctc
gccgccaagcgcgaggtctcggccgacgtcgaggccgccgtgcgcgtcatcgtcgacgat
gtggcgaagcgtggcgatgcggccctgctcgaggccacggcaaagttcgaccggctgaag
ctggatgcatccggcctgcgcgtctccgccgccgagatcgagacggccgtgaaggcctgc
gatgccgcgacgctggatgcgctcaagctcgcgcgcgaccgcatcgagacctatcaccgc
cgccagctcccgaaggacgagcgcttcaccgatccgctcggcgtcgagctcggctggcgc
tataccgcgatcgaatccgcgggcctctacgtgcccggcggcaccgcggcctatccctcc
tcggtgctgatgaacgcggtgcccgcgaaggtcgccggcgtcgcgcgcctcgtcatggtg
gtgccgtcgccggacggcaagctcaatccgctggtgctggcggccgcttcgcttggcggt
gtcagcgagatctaccgggtcggcggcgcgcaggcggtggcggcgctcgcccacggtacc
gccacgatcgcgccggtggccaagatcgtcggccccggcaatgcgtatgtcgccgccgca
aaacggctggtgttcggcaaggtcggcatcgacatgatcgcgggcccctccgaggtgctg
gtgatcgccgacgacaccggcaatgccgactggatcgccgctgatctgctggcgcaggcc
gaacacgacgccagcgcgcaatcgatcctgatcacggattccgcgcgcctcgccaccgat
gtcgagaaggccgtcgaagcgcagctgaagacattgccgcgcacagcaattgccggcgcc
tcctgggccgatttcggcgccatcatcatggtgaagaatcttgccgacgccattccgctc
gcggatgcgatcgcggccgagcatctcgagatcatgactgatgatcccgacgcgcttgcc
gcaaagatccgcaatgctggcgcggtgttcctcggcgcgcatacgcccgaggcgatcggc
gactatgtcggcggctccaaccacgtgctgccgacggcgcgctcggcgcggttctcctca
ggccttggagttgccgacttcatgaagcgcacctcgatcctgaaatgcggtccggaccag
ctgcgtgcgctcggacctgccgcgatgacgctcggacaagcggaggggctggacgctcat
tcgcgctcgattggattgcgcctcaatctgtcatga

DBGET integrated database retrieval system