KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_15660Help
Entry
BJ6T_15660        CDS       T01848                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
bju00051  Fructose and mannose metabolism
bju01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BJ6T_15660
Enzymes [BR:bju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BJ6T_15660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: BAL06848
UniProt: G7D215
Position
complement(1640279..1640992)
Genome map
AA seq 237 aa AA seqDB search
MTDRNHADLRQGIVDTCKEMNRSGLNQGTSGNLSHRIPNGMLITPTSLPYERMRPEDIVA
MDFSANYQGNHRPSSEWRFHRDILRARDDINVVLHTHSTFSTILAVHERGIPCFHYMVAV
AGGNDIRCSPYACFGTQSLSDYAVDALEGRNACLLGHHGLIVTAQTFEKALWLAVEVETL
AKMYVHALAIGEPPRLSETEMAQVHEQMKRMGYGQAPDLDDVGDVPRAMPQSKLAPH
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccgcaatcatgccgatctccgccagggcatcgtcgatacctgcaaggagatg
aaccgaagcggtctcaaccaagggacttccggcaatctttcgcatcggattccaaacggc
atgctaatcacaccgacaagcttgccctacgagcgtatgcggccagaagacattgtcgcg
atggatttttccgcgaattaccagggcaaccatcgcccttcttcagaatggcgttttcat
cgcgatattctgcgcgcgcgggacgacataaacgtcgtgcttcatacgcattccaccttc
agcaccattctcgccgtgcacgagcgtggcattccctgcttccactacatggtcgcggtc
gccggtggcaacgatatccgttgttcgccttatgcctgcttcggcacacaatcgctgtcg
gattatgccgtcgatgcgctcgaaggacgaaatgcctgcttgctcggccatcacggcttg
atcgtaacggcgcagacatttgaaaaggcgctttggcttgccgtggaggtggagaccctg
gcgaagatgtatgtccacgcgttggcgatcggcgaacctccgcgcctcagcgagaccgaa
atggcacaggtccacgaacagatgaaacgcatgggctacggccaagcgcccgatcttgac
gacgtcggtgatgttccacgcgccatgcctcagtcgaaactggcgccacattga

DBGET integrated database retrieval system