KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_16390Help
Entry
BJ6T_16390        CDS       T01848                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BJ6T_16390
Enzymes [BR:bju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BJ6T_16390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1713286..1714233
Genome map
AA seq 315 aa AA seqDB search
MTLISIPSNPVPEDVVSGTIKTPDGAELRFARWAPPANRKGTVCVFTGRSEQIEKYFETV
RDLRDRGFAVAMIDWRGQGHSSRRLRDPRKGYVRDFSDFEIDVETFVQQVVLPDCPPPFF
ALAHSMGGTVMLRVAHAGKRWFDRMVLSAPMIDLPGRATSFPARALLKTMRLMGMGGRYV
PGGSDHITGLNPFINNPLTSDPVRYARNVAILEEDPTLGLASPTVAWADAAFRAMNTFKG
KNYPSEIRQPILMLAASSDNVVSTAAIEEFAYHLRAGSHLVIAGAKHEILQEQDRYRSQF
WAAFDAFVPGTPLFK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgatctcgattccgtccaatcccgttcccgaagacgtcgtcagcggcaccatc
aagacacccgatggcgccgagctgcgctttgcgcgctgggcgccgcctgcgaaccgcaag
ggcacggtctgcgtcttcaccggacgcagcgagcagatcgagaaatatttcgagaccgtg
cgcgacctgcgcgaccgcggcttcgcggtggcgatgatcgactggcgcgggcagggccac
tcctcgcgccgcctgcgcgatccgcgcaagggctatgtgcgcgacttctccgatttcgag
atcgacgtcgagaccttcgtgcagcaggtggtgctgccggattgcccgccgcccttcttc
gcgctggcccattccatgggcggcacggtgatgctgcgggtggcgcatgccggcaagcgc
tggttcgaccgcatggtgctgtcggcgccgatgatcgacctgcccggtcgcgccacctcg
tttccggcacgggcgctgctgaagacgatgcgcctgatggggatgggcggtcgctatgtc
cccggcggcagcgaccacatcaccgggctcaatcccttcatcaacaatccgctgaccagc
gatcccgtgcgctatgcgcgcaatgtcgcgatcctggaggaggatccgacgctcgggctc
gcgtcaccgacggtcgcctgggccgatgccgccttccgcgccatgaacaccttcaagggc
aagaactacccctccgagatccgccagccgatcctgatgctggcggcctccagcgacaac
gtggtctcgaccgcggcgatcgaggagttcgcctatcatttgcgcgccggctcccatctc
gtgatcgccggtgccaagcacgagatactccaggagcaggaccgctaccgctcccagttc
tgggccgccttcgacgccttcgtgccgggcacgccgctgttcaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system