KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_16750Help
Entry
BJ6T_16750        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BJ6T_16750
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BJ6T_16750
Enzymes [BR:bju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BJ6T_16750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1751343..1752707
Genome map
AA seq 454 aa AA seqDB search
MQFLGRIGLVLLWLAAPLVAFAAANKNDPYLVPLRGAGNLALVAASLAIVILLLRRGRWR
TIAGKPLVVLWCLPPVLMSVAHLKFELRKHEVLAASAAEARQLGPHFMVGYSSFPEVARL
AEQGLIGGVYVTRRNIRGRTVETLRTEIAALQDKRRAAGLPPLVVAADQEGGIVGHLAPP
LTRVPALATLSGLAPDEQQAKAEEFGRTHGRELAGLGVNLNLAPVLDLKPPVRRNRLDFH
TLIGQRAIATDPAVVSTIASAYVRGLEESGVGATLKHFPGIGRVRTDTHHFSANLDTPVK
ELEATDWLPFREVLSHSRSALMVGHVTLTTVDPDRAASHSKRVIDGIIRDKWGYQGMVMT
DDLVMGAIYQHDVCKAVVEAINAGVDLLLVAYDGAQFYRVFACALDGARQGKLDAAMLRT
SAARLARGFPTEQARANLDVVRVVERHQPFANWR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcctcggtcgtatcggtctcgtcctgctctggctggccgcgccgcttgtcgca
ttcgccgctgccaacaagaacgatccctatctggtcccgctgcgcggcgccggaaacctc
gcgcttgtcgccgcaagcctcgcgatcgtcatcctcctgctgcgcaggggacggtggcgc
accatcgcgggcaagccgctcgtcgtgctctggtgcctgccgccggtcctgatgtcggtg
gcgcatctcaagttcgagctgcgcaagcacgaggtgcttgccgcgagcgccgccgaggcg
cgtcagctcggacctcacttcatggtgggctattcctcctttcccgaggttgcgcgcctc
gccgagcagggcttgatcggcggcgtctacgtgacccggcgcaacatccgtggccggacc
gtcgagacgttgcgcaccgagatcgcggcgctccaggacaagcggcgcgccgccggcctg
ccgccgctggtcgttgcggcagaccaggagggcggcatcgtcggacatctcgcgccgccg
ctgacgagggtgccggcactggcgacgctcagcgggctcgcccccgacgaacagcaggcc
aaggccgaagagttcggccgtacccacggccgcgagctcgccgggctcggcgtcaacctc
aacctcgcgccggtgctcgacctcaagccgccggtgcggcgcaatcgcctcgattttcat
acgctgatcggccagcgcgcgattgcgaccgaccctgccgtcgtcagcacgatcgcgagc
gcctatgtgcgcgggctggaagagtcaggcgtcggtgctacgctgaagcattttcccggt
atcggccgcgtccgcaccgacacgcatcatttcagcgccaatctcgatacgccggtgaaa
gagctcgaagccaccgactggctaccgttccgcgaggtgctgtcgcattcgcgcagcgcg
ctcatggttgggcatgtcacgctgacgaccgtcgatcccgatcgcgccgcctcgcattcg
aaacgcgtcatcgatggcatcatccgcgacaagtggggttaccagggcatggtgatgacc
gacgacctcgtgatgggggcgatctaccagcacgacgtctgcaaagccgtggtcgaggcg
atcaacgccggcgtcgatctgctgctggttgcctatgacggcgcgcaattctaccgggtc
ttcgcctgcgcgctggatggggcgcggcagggcaagctcgacgcggcgatgctgcgcacg
agcgcggcgcggttggcgcggggcttcccgaccgagcaggcgcgggccaacttagacgtc
gtccgcgttgtcgagcggcatcagcccttcgcgaactggcggtag

DBGET integrated database retrieval system