KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_17250Help
Entry
BJ6T_17250        CDS       T01848                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bju  Bradyrhizobium japonicum USDA 6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1809611..1810495
Genome map
AA seq 294 aa AA seqDB search
MEDRSAKYRAFYAQLICAAAKTTDPRIEQAFRTVRREPFAGPGPWSISVGGHPYVVTPDD
DPAFLYQNTLLALEPARGLNIGMPGAHAYWLSGCGVKEGETVIQIGAGSGYYTAILAELT
GPSGRVHAYEIDERLAALARENLKDIPHVELEDRSGIASDLPAANVIYVCAGAAQPATQW
LDALRPRGRLVFPLAPEGMLGGMLMITRPEEGAVWPAKFLSRAQFIGCAGLQDADAGRRL
SETFAKGWESVQSLRRGGAADETCWFAGEGWWLSTAAALVPTVPIKPHADLTQA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaagatcgttcggcaaaatatcgcgcattctatgcgcagttgatctgcgctgcggcc
aagacgacggatccccgtatcgagcaggcctttcgcacggtcaggcgcgaacccttcgcc
ggacccggaccgtggtcgatctccgtcggtggccatccctatgtcgtgacgcccgacgac
gatcccgccttcctctatcagaacacgcttctggcgctggagccggcgcgcggcctcaat
atcgggatgcccggcgcgcacgcctattggctcagcggctgcggcgtgaaggaaggcgag
acggtcatccagatcggtgccggcagcggctactacacggccattctcgccgagctcacg
ggaccttcgggccgtgtccatgcctatgagatcgacgaacgcctggcggcactcgcgcgc
gaaaatctgaaggacatcccgcatgtcgagctggaagatcgctcgggcatcgcgtccgat
ttaccggccgcgaatgtgatctatgtctgtgcgggcgcggcacagccggccacgcaatgg
ctcgatgcgctgcggccccgcggccggctggtgttcccgttggcgccggagggcatgctc
ggtggcatgttgatgatcacgcgcccggaggagggcgcggtctggccggcgaaattcctg
agtcgagcccaattcatcggctgcgcgggactgcaggacgcggatgccggccggcgattg
tccgagaccttcgccaaaggatgggagagcgtgcagtcgctgcgcagaggcggcgctgcg
gacgagacgtgctggtttgccggtgagggctggtggctttcgaccgctgcggcgctcgtc
ccgacggttccaatcaagccccacgccgacctcacgcaggcgtga

DBGET integrated database retrieval system