KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_17450Help
Entry
BJ6T_17450        CDS       T01848                                 

Definition
cytochrome C550,cytochrome C550
Orthology
K08738  
cytochrome c
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BJ6T_17450
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BJ6T_17450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1825143..1825538)
Genome map
AA seq 131 aa AA seqDB search
MTKLTFGALMILTVTATAPAAMAQDVAAGKSSFNKCLACHAIGEGAKNKVGPELNGLNGR
KSGTAPDYNYSDANKNSGITWDEATFKEYIKDPKAKIPGTKMAFAGIKNENEINNLWAFV
AQFDKDGKIKQ
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaactgacttttggcgcactgatgatcctcaccgtgactgccaccgcacccgcc
gcgatggcgcaggatgttgcggccggcaaatcgtcgttcaacaaatgcctggcctgccac
gcgatcggcgaaggcgccaagaacaaggtcggccccgagctcaacggcctcaacggccgc
aagtccggcaccgcgccggactacaattactcggatgcgaacaagaattccggcatcacc
tgggacgaagccacgttcaaggaatacatcaaggaccccaaggccaagatccccggcacc
aagatggcgttcgccggcatcaagaacgagaacgagatcaacaatctctgggccttcgtc
gcgcagttcgacaaggacgggaaaatcaagcagtaa

DBGET integrated database retrieval system