KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_21560Help
Entry
BJ6T_21560        CDS       T01848                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BJ6T_21560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BJ6T_21560
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BJ6T_21560
Enzymes [BR:bju01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BJ6T_21560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2229092..2230219
Genome map
AA seq 375 aa AA seqDB search
MPAASYIDPRNGTLYALEQPRWCSDERTPLLVTPGAGISREDIDSRTRSLWRYRAALPVE
IKNPISLGEGCTPLVQQAWGDLRPFFKLEWFNPTGSFKDRGSAVMLSFLRQIGVDAILED
SSGNGGSSMAGLGAAGGMRVKILAPASTSPAKIAQVRAYGATVQLVEGPREESEAEAIRQ
SSQTFYASHNWQPFFLEGTKSLAYEIWEDFGFRAPDNVIVPVGAGSSLLGCAFGFRELLK
AGQITKLPRLFAAQPQNCSPIDASFKAGVDTPVAREVNKTIAEGTAIKNPLRLREIIGAL
RESGGGTVALTEDEIVAALRRLARQGLFAEPTSASAAAALEKLSAAGAIKANETTVAVLT
GTGLKAATTVADLVQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagccagctacatcgacccccgtaatggaacgctctacgcgctggagcagccg
cgctggtgctcggacgagcgcacgccgctgctggtgacgccgggggcagggatctcgcgc
gaggacatcgacagccgcacgcgatcattgtggcgctaccgggcggcgctgccggtggag
atcaagaatccgatctcgctcggcgaaggctgcacgccgctggttcaacaggcctggggt
gacctgcgcccgttcttcaagctcgaatggttcaaccctaccggcagcttcaaggatcgc
ggctcggcggtgatgctgtccttcctgcggcagatcggcgtcgatgcgatactcgaagac
tcctccggcaatggcggctcgtcgatggcggggttaggagccgccggcggcatgcgcgtg
aagattctggcgcccgcctcgacatcgccggccaagatcgcgcaggtgcgcgcctatggc
gcgacggtgcagctcgtcgagggcccgcgcgaggagtcggaagccgaggccattcggcag
tcgagccagaccttttacgccagccacaattggcagccgttctttctcgaaggcaccaaa
tcgctcgcctatgaaatctgggaagattttggattccgcgcgcccgacaacgtgatcgtc
cccgtcggcgccggcagcagcctgctcggctgcgccttcggcttccgcgagttgttgaag
gccggccagatcacaaagctgccgcgcctgttcgcggcgcagccgcaaaactgttcgccg
atcgatgcgagcttcaaggccggtgtcgacacgcctgtcgcgcgtgaggtgaacaaaacc
atcgccgaaggcaccgcgatcaagaatccgctgcggctgcgtgagatcatcggcgccctg
cgcgagagcggcggcggcaccgttgcgctgaccgaggacgagatcgtcgcagccttgcgt
cgtcttgcgcggcagggcctgttcgcggagccaaccagtgccagcgcggccgctgcgctg
gaaaagctctcggctgctggagcgatcaaggcgaacgagaccacggtcgcggtcctcacc
ggtacggggctgaaggccgcaaccactgtcgccgatctcgtgcagtag

DBGET integrated database retrieval system