KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_21870Help
Entry
BJ6T_21870        CDS       T01848                                 

Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bju00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BJ6T_21870
Enzymes [BR:bju01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BJ6T_21870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2254997..2255614)
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGLIDSYGEDYVLLDVGGVGYQVHCSARTLQHLPAPGEVAVLSIETYVREDQIKL
FGFRTDQEREWFRLLQTVQGVGAKVALAVLGTLAPSDLANAIALRDKAAVARTPGVGPKV
AERIVTELKDKAPAFANVDPAVVHLAGAVDDQRAPRPVADAISALVNLGYGQPQAAAAIA
SASRSAGEHAETAQLIRLGLKELAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggcctgatcgattcctacggcgaggattatgtcctcctcgac
gtcggcggcgtcggctatcaggtgcattgctcggcgcgcacgcttcagcatctgccggcg
cccggcgaggtcgcggtgctgtcgatcgagacctatgtccgcgaggaccagatcaagctg
ttcggcttccgcaccgaccaggagcgcgaatggtttcgcctgctccagaccgtgcagggc
gtcggcgccaaggtcgcgctcgccgtgctcggcacgctggcgccttccgatctcgccaac
gccattgcgctccgtgacaaggccgcggtggcgcgtacgcccggtgtcggccccaaggtg
gccgagcgcatcgtcaccgaattgaaggacaaggcgccggccttcgccaatgtcgatccc
gccgtcgtgcatctcgccggcgccgtcgacgaccagcgcgcgccgcgcccggtggcagat
gcgatctcggcgctcgtcaatctcggttacggccagccgcaggccgccgcggccatcgca
tcggcatcgcgtagcgcgggtgagcatgccgagaccgcacagctcattcgcctcggcctc
aaggagctcgcgaagtga

DBGET integrated database retrieval system