KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_22930Help
Entry
BJ6T_22930        CDS       T01848                                 

Definition
NAD(P)+ transhydrogenase subunit beta
Orthology
K00325  
NAD(P) transhydrogenase subunit beta [EC:1.6.1.2]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BJ6T_22930
Enzymes [BR:bju01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     BJ6T_22930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2368944..2370341
Genome map
AA seq 465 aa AA seqDB search
MSANLSAFLYLVAGVLFILSLRGLSSPASSRQGNLFGMIGMAIAVATTLANHPPADGLAW
VLVIVGIAIGAAIGAVIARRVPMTSMPELVAAFHSLVGMAAVLVAAGAFYAPEAFDIGTP
GNIHPQSLVEMSLGVAIGALTFTGSVIAFLKLSARMSGAPVILPARHIINIAIAVALVFF
IVRLVLTGGALDFWLIVILALALGVLMIIPIGGADMPVVISMLNSYSGWAAAGIGFTLGN
SALIITGALVGSSGAILSYIMCHAMNRSFISVILGGFGGETAAAGGGTGEQKPAKLGSAD
DAAFIMKNASKVIIVPGYGMAVAQAQHALREMADMLKKEGVEVKYAIHPVAGRMPGHMNV
LLAEANVPYDEVFELEDINSEFAQADIAFVIGANDVTNPAAEEDKTSPIYGMPVLQVWKA
GTVMFIKRSLASGYAGIDNPLFYRDNTMMLLGDAKKVTENIVKAM
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaacctctctgcatttttgtatctcgtggcgggagtgctgttcatcctgtcg
ctacgcgggctgtcgagcccggcttcgtcgcgccagggcaatctgttcggcatgatcggc
atggcgatcgcggtcgccaccacgctcgccaaccatccgccggcagacggcctcgcctgg
gtgctcgtcatcgtcggcatcgccatcggtgccgcgatcggcgcggtcatcgcccgccgc
gtgccgatgacctcgatgccggaactggtcgccgccttccactcgctggtcggcatggcc
gcggtgctggtcgccgcgggtgcgttctacgcacccgaggctttcgacatcggcaccccc
ggcaacatccatccgcagagcctggtcgagatgtcgctcggcgtcgccatcggcgcgctg
accttcaccggctcggtgatcgcgttcctgaagctgtccgcgcggatgagcggcgcgccg
gtcatcctgcccgcccgtcacatcatcaacatcgcgattgccgtggcgctggtgttcttc
atcgtccgcctggtcctcaccggcggcgcgctcgacttctggctgattgtcatcctggcg
ctggcgctcggcgtgctcatgatcatcccgatcggcggcgccgacatgccggtcgtgatc
tcgatgctgaactcctattccggctgggccgcggccggcatcggcttcacgctgggcaat
tccgcgctgatcatcaccggcgcgctggtcggctcgtccggtgcgatcctgtcctacatc
atgtgccacgcgatgaaccggtccttcatctcggtcatcctcggcggcttcggcggcgag
accgctgcggccggcggcggtacgggcgagcagaagccggccaagctcggctcggccgat
gacgccgccttcatcatgaagaacgcctccaaggtcatcatcgtgcccggctacggcatg
gcggtggcgcaggcgcagcacgcgctgcgcgaaatggccgacatgctgaagaaggaaggc
gtcgaggtgaagtacgccattcacccggtcgcgggccgcatgcccggccacatgaacgtg
ctgctcgccgaggccaacgtcccctacgacgaggtgttcgagctcgaggacatcaactcc
gaattcgcgcaggccgacatcgccttcgtgatcggcgccaacgacgtcaccaacccggcg
gccgaagaggacaagacctcgccgatctacggcatgcccgtcctgcaggtctggaaggcc
ggcaccgtgatgttcatcaagcgctcgctcgcctcgggctatgccggtatcgacaatccg
ctgttctaccgcgacaacaccatgatgctgctcggcgacgccaagaaggtcaccgagaac
atcgtcaaggcgatgtag

DBGET integrated database retrieval system