KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_26510Help
Entry
BJ6T_26510        CDS       T01848                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BJ6T_26510
Enzymes [BR:bju01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BJ6T_26510
Exosome [BR:bju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJ6T_26510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2726407..2728554)
Genome map
AA seq 715 aa AA seqDB search
MPKLPAEAYAIIEGRHSDPFHYLGLHPEGGKSVVRAFLPEATNVEAVGEHGEVAKLDRVH
DSGLFIGALPNGSKRYQLRARFGDNIVEFEDAYRFPPILTDFDLYLLGEGTHQRLYDKLG
AHPMRLEGIDGIGFVVLAPNARRVSVVGDFNFWDARRHPMRVRGAGYWELFIPHAKGGDH
YKFDIIGPHGHQLPLKSDPMAFASEVRPKTASIVFDEAHLARPRPAPDGINALSAPMSIY
EVHLGSWRRKNGDEWLTYRELAEQLPAYARDMGFTHLEFLPVSEHPFDGSWGYQPTGLYA
PTSRFGGPEDFAALVDACHREGVGVLLDWVPGHFPDDPHGLGSFDGTSLYEHANPLQGRH
LDWGTLIYNYGRTEVTNFLVSNALFWLERYAIDGLRVDAVASMLYLDYSRPPGAWIPNQY
GGRENIEAIAFLRRFNTELFARFPQATTAAEESTAWPQVSRPVEFGGLGFGYKWNMGWMH
DTLNYISKDPIHRKHHHGEILFGLHYAFSENFILPLSHDEVVHGKRSILGRMPGDEWQRF
ANLRAYYSFMFGHPGKKLLFMGAEIAQSREWNHDQSLDWHLLEYKYHSGIQALIRDLNRL
YRAVPALHQMDCEQGGFEWLITDDANRNVFAWLRKGFDEHARCLVIINFSPNVYRNYRVP
VPLAGKWKEVFNSDSAHYGGTNVGNIGEVHAAGGKVPELRLTVPPLAAIFLVPES
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaactgccagccgaggcctacgcgatcatcgagggccgccactccgaccccttc
cattatctcgggttgcatcccgagggcggcaagagcgtggtgcgcgcgttcctccccgag
gccaccaatgtcgaggcggtgggcgaacatggcgaggtggcgaagctcgatcgcgtccac
gattcgggcctgttcatcggcgccctgccgaacggctcgaagcgctaccagctccgcgcc
aggttcggcgacaacatcgtcgagttcgaggacgcctatcgcttcccgccgatcctgacc
gacttcgatctctatctgctcggcgaaggcacccatcagcgcctctacgacaagctcggc
gcgcatccgatgcggctcgaaggcatcgacggaatcggcttcgttgtgctggcgccgaac
gcgcggcgggtgtccgtggtcggcgatttcaatttctgggacgcgcggcgccatccgatg
cgggtccgcggtgccggttattgggagctgttcatcccgcacgccaagggcggcgaccac
tacaagttcgatatcatcggtccgcacggccatcagttgccgctgaagtccgatcccatg
gcctttgcgagcgaggtgcggccgaagacggcttccatcgtgttcgacgaggcacatctc
gcacgcccgcgcccggcaccggatggcatcaacgcgctctcggcgccgatgtcgatctac
gaggtccatctcggctcctggcggcgcaagaacggcgacgaatggctcacctatcgcgaa
ctggccgagcagctgccggcctatgcccgcgacatgggctttacccatctcgaattcctg
cccgtcagcgagcatccgttcgacggctcctggggctatcagccgaccggcctctatgcg
ccgaccagtcgcttcggcgggcctgaggattttgccgcgctggtcgatgcctgccatcgc
gagggcgtcggcgtgctgctcgactgggtgcccggccatttccccgacgatccgcacggg
ctcggcagcttcgacggcacctcgctctacgagcatgccaatccgctccagggccgccac
ctcgactggggcacgctgatctacaattacggccgcaccgaagtgacgaacttcctggtg
tcgaacgcactgttctggctcgagcgttacgcgatcgacggcctgcgcgtcgatgcggtc
gcctccatgctctatctcgactacagccgcccgccgggcgcctggattccgaaccagtat
ggcggccgcgagaacatcgaggcgatcgcgttcctgcgccgcttcaacaccgaattgttc
gcgcgcttcccgcaggcaaccacggcggccgaggaatccaccgcgtggccgcaggtctcg
cgcccggtcgaattcggcgggctcggcttcggctacaagtggaacatgggctggatgcac
gacacgctgaactacatcagcaaggatccgattcaccgcaagcatcatcacggcgagatc
ctgttcggcctgcattacgctttctcggagaacttcatcctgccgctgtcgcatgacgag
gtcgtgcacggcaaacgttcgatcctcggccgcatgcccggcgacgaatggcagcgcttt
gcgaatttgcgcgcctattacagcttcatgttcggccatcccggaaagaagctgctgttc
atgggcgcggagatcgcgcaaagccgcgaatggaatcacgaccagtcgctcgactggcac
ctgctcgaatacaagtaccattccggcatccaggcgctgatccgcgacctcaaccggctc
tatcgcgcggtgccggcgctgcaccagatggattgcgaacagggcggattcgaatggctg
atcacggatgacgccaaccgcaacgtgttcgcctggctgcgcaagggattcgacgagcac
gcacggtgtctcgtgatcatcaacttctcacccaacgtctatcgcaactatcgcgtcccc
gtgcccctcgccggcaagtggaaagaggtgttcaattcggactccgcccattacggcggc
accaatgtcggaaacatcggcgaggttcatgccgctggcggcaaggtgcccgagcttcgc
ctcaccgttccgccgctcgccgcgatcttcctcgttccggaaagctga

DBGET integrated database retrieval system