KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_26540Help
Entry
BJ6T_26540        CDS       T01848                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bju00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2733999..2735960
Genome map
AA seq 653 aa AA seqDB search
MDLLAQARIKGVQSEFVDALGKLRVTDPVALKSILEALPEKRVYRFVGGPVVVRALGHPR
TELTTIGAPPLQWTLRANGNVIAQGETREPVIAWPASLPLGYHRLTLTDAKGVAEEVPMI
VAPERAFGGDFARGWLLAVQLYSVRSDRNWGIGDFTDLADLVRLARQLGADGVGLNPLHV
LFDNHPADCSPYSPNSRLFLNPLYIDVEAIPEFSVDLVPDAAATAARLREGDRVPYADMA
ALKWLGLRAAYNSFVTSASEARRKEFDAFRADRAPLLSRFACFEVLRHRFAGPWWEWPQE
WQQPDEAKCAELRNGPDKREVEFVEFVQWTADSQLHAAKELAGQLGMRVGLYLDVAVGVQ
SNGFDAWNEQMAISRHLAVGAPPDVLNTVGQDWGLAGFNAGGLEAQSFVPFADMLAASMR
HAGAIRLDHVLGLKRLYLVPRGFKPDNGAYVQMPFEALLGAVVRESAAHKCIVIGEDLGT
VPEGFRETMQDFGIWSYLVMMFERDDAGRFRNADHYRPNALVTLNTHDLCTYAGWRSFSD
LKMKRSLGLDPGENDQARWDALGRLDEILRQNGINANDLYSVLAFLSRTPSRLLAVSLED
LLGVIDQPNIPGTIDEHPNWRQRLPVALDKIAAKVDATALKAATRERSLTGGS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttagctcaagcccggatcaagggcgttcagtccgaattcgtcgatgccctc
ggaaagctgcgggtcaccgatcccgtggccctcaaatccatcctcgaggccctgccggag
aagcgggtttaccgcttcgtcggcgggcccgtggtggtgcgcgccctgggacatccgcgc
accgaattgacgacaatcggcgcgccgccgctgcaatggacattgcgcgcaaacggcaat
gtgatcgcgcaaggcgagacgcgcgaacccgtgatcgcctggcccgccagcctgccgctc
ggttatcaccggttgacgctgaccgatgccaagggtgttgcggaagaggtgccgatgatc
gtggcgcccgaacgcgccttcggcggcgatttcgcccgcggctggctgcttgccgtgcag
ctctacagcgtccgctcggaccgcaattggggcattggcgatttcaccgacctcgccgat
ctcgtccggctcgccaggcagctcggcgccgatggcgtcgggctcaatccgctgcatgtc
ctgttcgacaaccatcccgccgattgcagcccctattcgccgaacagccggctgtttctc
aatccgctctatatcgacgtcgaggcgatcccggaattttccgtcgacctcgtccccgac
gcggccgcgaccgccgcgcggctgcgcgaaggcgatcgtgtgccctatgcggacatggcg
gcgttgaaatggctcggcctgcgcgccgcctacaacagtttcgtgacgagtgcgagcgag
gcgcgccgcaaggaattcgacgccttccgcgccgaccgggcgccgctgttgtcccgcttt
gcctgctttgaggtgctgcggcatcgcttcgccgggccttggtgggagtggccgcaagag
tggcagcagccggatgaagccaaatgcgccgagctccgcaacggtcccgacaagcgcgag
gtcgagttcgtcgaattcgtgcaatggacggccgatagccaattgcatgccgccaaggaa
ttggccggccagctcggcatgcgcgtcgggctctatctcgacgtcgccgtcggcgtgcag
tccaacggcttcgacgcctggaacgagcagatggcgatttcgcgccatctcgccgtcggc
gcgccgcccgacgtgctcaacaccgtcggacaggattggggtcttgccggcttcaatgcc
ggcggtctggaggcgcaatccttcgtgccgttcgccgacatgctggccgcctcgatgcgc
catgccggcgcgatccggctcgatcacgtgctgggcttgaaacggctgtatctggtgccg
cgcggcttcaagccggacaacggtgcctatgtgcagatgccgttcgaagcgctgctcggc
gccgtggtgcgcgagagcgcggcgcacaaatgcatcgtgatcggcgaggacctcggcacc
gtgccggaaggttttcgcgagaccatgcaggatttcggcatctggtcctacctcgtcatg
atgttcgagcgcgacgatgccggccgtttccgcaatgccgaccattaccggcccaacgcg
ctggtcacgctgaacacgcatgatctgtgcacctatgccggctggcgctccttcagcgat
ctcaagatgaagcgctcgctcgggctcgaccccggcgagaacgaccaggcgcgctgggat
gcgctcggcaggctcgacgagatcctgcgccagaacggcatcaacgccaacgatctctat
tcggtgctcgccttcctgtcgcggacgccgtcgcgacttctggcggtgtcgcttgaggat
ctgctcggcgtgattgaccagcccaacattcccggtacgatcgatgagcatccgaactgg
cgccagcgcctgccggtggcgctcgacaagatcgccgccaaggtcgatgctacggccttg
aaggcggcgacgcgggaacgctcgttgaccggcgggagttga

DBGET integrated database retrieval system